DNASE2B anticorps (Middle Region)
-
- Antigène Voir toutes DNASE2B Anticorps
- DNASE2B (Deoxyribonuclease II beta (DNASE2B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DNASE2B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DNASE2 B antibody was raised against the middle region of DNASE2
- Purification
- Affinity purified
- Immunogène
- DNASE2 B antibody was raised using the middle region of DNASE2 corresponding to a region with amino acids IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG
- Top Product
- Discover our top product DNASE2B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DNASE2B Blocking Peptide, catalog no. 33R-4011, is also available for use as a blocking control in assays to test for specificity of this DNASE2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DNASE2B (Deoxyribonuclease II beta (DNASE2B))
- Autre désignation
- DNASE2B (DNASE2B Produits)
- Synonymes
- anticorps DNASE2, anticorps deoxyribonuclease-2-beta, anticorps DLAD, anticorps DNASE2B, anticorps dnase2b, anticorps AI526873, anticorps Dlad, anticorps DnaseIIb, anticorps UOX, anticorps deoxyribonuclease 2 beta, anticorps deoxyribonuclease II beta, anticorps DNASE2B, anticorps dnase2b, anticorps Dnase2b
- Sujet
- DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs. The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II.
- Poids moléculaire
- 39 kDa (MW of target protein)
-