SLC39A11 anticorps
-
- Antigène Voir toutes SLC39A11 Anticorps
- SLC39A11 (Solute Carrier Family 39 (Metal Ion Transporter), Member 11 (SLC39A11))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC39A11 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC39 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIG
- Top Product
- Discover our top product SLC39A11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC39A11 Blocking Peptide, catalog no. 33R-3300, is also available for use as a blocking control in assays to test for specificity of this SLC39A11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC39A11 (Solute Carrier Family 39 (Metal Ion Transporter), Member 11 (SLC39A11))
- Autre désignation
- SLC39A11 (SLC39A11 Produits)
- Synonymes
- anticorps 1810074D23Rik, anticorps C17orf26, anticorps ZIP11, anticorps solute carrier family 39 member 11, anticorps solute carrier family 39 (metal ion transporter), member 11, anticorps solute carrier family 39, member 11, anticorps SLC39A11, anticorps slc39a11, anticorps Slc39a11
- Sujet
- SLC39A11 belongs to the ZIP transporter family. It is a multi-pass membrane protein. SLC39A11 may act as a zinc-influx transporter.
- Poids moléculaire
- 35 kDa (MW of target protein)
-