CHST13 anticorps
-
- Antigène Voir toutes CHST13 Anticorps
- CHST13 (Carbohydrate (Chondroitin 4) Sulfotransferase 13 (CHST13))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHST13 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CHST13 antibody was raised using a synthetic peptide corresponding to a region with amino acids CHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAASRDL
- Top Product
- Discover our top product CHST13 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHST13 Blocking Peptide, catalog no. 33R-1710, is also available for use as a blocking control in assays to test for specificity of this CHST13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHST13 (Carbohydrate (Chondroitin 4) Sulfotransferase 13 (CHST13))
- Autre désignation
- CHST13 (CHST13 Produits)
- Synonymes
- anticorps C4ST3, anticorps carbohydrate sulfotransferase 13, anticorps CHST13
- Sujet
- CHST13 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-