C1QTNF1 anticorps (N-Term)

N° du produit ABIN635746

Détail du produit anti-C1QTNF1 anticorps

Antigène: C1QTNF1 (C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1QTNF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 QTNF1 antibody was raised against the N terminal of C1 TNF1

Purification: Affinity purified

Immunogène: C1 QTNF1 antibody was raised using the N terminal of C1 TNF1 corresponding to a region with amino acids YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1QTNF1 Blocking Peptide, catalog no. 33R-10194, is also available for use as a blocking control in assays to test for specificity of this C1QTNF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 TNF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1QTNF1

Antigène: C1QTNF1 (C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1))

Autre désignation: C1QTNF1 (C1QTNF1 Produits)

Synonymes: anticorps C1QTNF1, anticorps CTRP1, anticorps GIP, anticorps ZSIG37, anticorps 1600017K21Rik, anticorps Zsig37, anticorps Ctrp1, anticorps zgc:113062, anticorps C1q and tumor necrosis factor related protein 1, anticorps C1q and TNF related 1, anticorps C1QTNF1, anticorps c1qtnf1, anticorps C1qtnf1

Sujet: C1QTNF1 may be considered a novel adipokine, providing an important framework to further address the physiological functions and mechanisms of the action of this family of secreted glycoproteins in normal and disease states.

Poids moléculaire: 23 kDa (MW of target protein)