FZD10 anticorps

N° du produit ABIN635799

Détail du produit anti-FZD10 anticorps

Antigène: FZD10 (Frizzled Family Receptor 10 (FZD10))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZD10 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FZD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FZD10 Blocking Peptide, catalog no. 33R-7152, is also available for use as a blocking control in assays to test for specificity of this FZD10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FZD10

Antigène: FZD10 (Frizzled Family Receptor 10 (FZD10))

Autre désignation: FZD10 (FZD10 Produits)

Synonymes: anticorps CD350, anticorps FZ-10, anticorps Fz10, anticorps FzE7, anticorps hFz10, anticorps cFz-10, anticorps Fz-10, anticorps Xfr9, anticorps Xfz10, anticorps frizzled-10, anticorps frizzled10, anticorps fz10, anticorps fze7, anticorps hfz10, anticorps fk48e04, anticorps fz4, anticorps fzb, anticorps wu:fk48e04, anticorps zg04, anticorps Xfz10A, anticorps fzd10a, anticorps Xfz10B, anticorps Xfz9, anticorps fzd10b, anticorps fzd9, anticorps frizzled class receptor 10, anticorps frizzled class receptor 10 L homeolog, anticorps frizzled class receptor 10 S homeolog, anticorps FZD10, anticorps fzd10, anticorps Fzd10, anticorps fzd10.L, anticorps fzd10.S

Sujet: FZD10 is a member of the frizzled family. Members of this family are 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Signalisation WNT