PILRB anticorps (Middle Region)

N° du produit ABIN635800

Détail du produit anti-PILRB anticorps

Antigène: PILRB (Paired Immunoglobin-Like Type 2 Receptor beta (PILRB))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PILRB est non-conjugé

Application: Western Blotting (WB)

Specificité: PILRB antibody was raised against the middle region of PILRB

Purification: Affinity purified

Immunogène: PILRB antibody was raised using the middle region of PILRB corresponding to a region with amino acids KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PILRB Blocking Peptide, catalog no. 33R-4545, is also available for use as a blocking control in assays to test for specificity of this PILRB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PILRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PILRB

Antigène: PILRB (Paired Immunoglobin-Like Type 2 Receptor beta (PILRB))

Autre désignation: PILRB (PILRB Produits)

Synonymes: anticorps FDFACT1, anticorps FDFACT2, anticorps FDFACT, anticorps Fdact, anticorps Pilrb, anticorps paired immunoglobin-like type 2 receptor beta, anticorps paired immunoglobin-like type 2 receptor beta 1, anticorps PILRB, anticorps Pilrb1, anticorps Pilrb

Sujet: Paired receptors consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRB is thought to act as a cellular signaling activating receptor that associates with ITAM-bearing adapter molecules on the cell surface.

Poids moléculaire: 23 kDa (MW of target protein)