FKBP11 anticorps (N-Term)

N° du produit ABIN635804

Détail du produit anti-FKBP11 anticorps

Antigène: FKBP11 (FK506 Binding Protein 11, 19 KDa (FKBP11))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FKBP11 est non-conjugé

Application: Western Blotting (WB)

Specificité: FKBP11 antibody was raised against the N terminal of FKBP11

Purification: Affinity purified

Immunogène: FKBP11 antibody was raised using the N terminal of FKBP11 corresponding to a region with amino acids VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FKBP11 Blocking Peptide, catalog no. 33R-9792, is also available for use as a blocking control in assays to test for specificity of this FKBP11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FKBP11

Antigène: FKBP11 (FK506 Binding Protein 11, 19 KDa (FKBP11))

Autre désignation: FKBP11 (FKBP11 Produits)

Synonymes: anticorps MGC85245, anticorps 1110002O23Rik, anticorps FKBP-11, anticorps si:dz202l16.2, anticorps wu:fd54d02, anticorps zgc:110640, anticorps FKBP19, anticorps FK506 binding protein 11 L homeolog, anticorps FK506 binding protein 11, anticorps fkbp11.L, anticorps FKBP11, anticorps Fkbp11, anticorps fkbp11

Sujet: FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin.

Poids moléculaire: 19 kDa (MW of target protein)