B3GALTL anticorps (Middle Region)

N° du produit ABIN635816

Détail du produit anti-B3GALTL anticorps

Antigène: B3GALTL (beta 1,3-Galactosyltransferase-Like (B3GALTL))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp B3GALTL est non-conjugé

Application: Western Blotting (WB)

Specificité: B3 GALTL antibody was raised against the middle region of B3 ALTL

Purification: Affinity purified

Immunogène: B3 GALTL antibody was raised using the middle region of B3 ALTL corresponding to a region with amino acids DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

B3GALTL Blocking Peptide, catalog no. 33R-2243, is also available for use as a blocking control in assays to test for specificity of this B3GALTL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALTL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur B3GALTL

Antigène: B3GALTL (beta 1,3-Galactosyltransferase-Like (B3GALTL))

Autre désignation: B3GALTL (B3GALTL Produits)

Synonymes: anticorps B3GLCT, anticorps B3GTL, anticorps B3Glc-T, anticorps Gal-T, anticorps beta3Glc-T, anticorps Gm1057, anticorps beta 3-glucosyltransferase, anticorps beta 3-glucosyltransferase L homeolog, anticorps beta-3-glucosyltransferase, anticorps B3GLCT, anticorps b3glct, anticorps b3glct.L, anticorps B3glct

Sujet: B3GALTL is the O-fucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. B3GALTL specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan.B3GALTL is a beta-1,3-glucosyltransferase involved in the synthesis of the unusual O-linked disaccharide glucosyl-beta-1,3-fucose-O- found on the thrombospondin type-1 repeats (TSRs) of many biologically important proteins.

Poids moléculaire: 56 kDa (MW of target protein)