GALNT4 anticorps
-
- Antigène Voir toutes GALNT4 Anticorps
- GALNT4 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 4 (GalNAc-T4) (GALNT4))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GALNT4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GALNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDI
- Top Product
- Discover our top product GALNT4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GALNT4 Blocking Peptide, catalog no. 33R-9559, is also available for use as a blocking control in assays to test for specificity of this GALNT4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GALNT4 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 4 (GalNAc-T4) (GALNT4))
- Autre désignation
- GALNT4 (GALNT4 Produits)
- Synonymes
- anticorps GALNAC-T4, anticorps GALNACT4, anticorps AV011803, anticorps polypeptide N-acetylgalactosaminyltransferase 4, anticorps polypeptide N-acetylgalactosaminyltransferase 4 L homeolog, anticorps GALNT4, anticorps galnt4.L, anticorps Galnt4
- Sujet
- GALNT4 is a member of the UDP-N-acetyl-alpha-D-galactosamine: polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain.
- Poids moléculaire
- 67 kDa (MW of target protein)
-