TMED10 anticorps

N° du produit ABIN635823

Détail du produit anti-TMED10 anticorps

Antigène: TMED10 (Transmembrane Emp24-Like Trafficking Protein 10 (TMED10))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMED10 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMED10 Blocking Peptide, catalog no. 33R-4515, is also available for use as a blocking control in assays to test for specificity of this TMED10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMED10

Antigène: TMED10 (Transmembrane Emp24-Like Trafficking Protein 10 (TMED10))

Autre désignation: TMED10 (TMED10 Produits)

Synonymes: anticorps tmp21, anticorps P24(DELTA), anticorps S31I125, anticorps S31III125, anticorps TMP21, anticorps Tmp-21-I, anticorps p23, anticorps 1110014C03Rik, anticorps Tmp21, anticorps p24delta1, anticorps fe06g04, anticorps wu:fb98e10, anticorps wu:fe06g04, anticorps zgc:85681, anticorps transmembrane p24 trafficking protein 10 L homeolog, anticorps transmembrane p24 trafficking protein 10, anticorps tmed10.L, anticorps TMED10, anticorps Tmed10, anticorps tmed10

Sujet: This gene is a member of the EMP24/GP25L/p24 family and encodes a protein with a GOLD domain. This type I membrane protein is localized to the plasma membrane and golgi cisternae and is involved in vesicular protein trafficking.

Poids moléculaire: 24 kDa (MW of target protein)