TMED10 anticorps

N° du produit ABIN635823

Cet anticorps anti-TMED10 Polyclonal Lapin (ABIN635823) détecte spécifiquement TMED10 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TMED10 anticorps (ABIN635823)

Antigène: TMED10 (Transmembrane Emp24-Like Trafficking Protein 10 (TMED10))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMED10 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMED10 anticorps

Purification: Affinity purified

Immunogène: TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMED10 Blocking Peptide, (ABIN939901), is also available for use as a blocking control in assays to test for specificity of this TMED10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMED10

Antigène: TMED10 (Transmembrane Emp24-Like Trafficking Protein 10 (TMED10))

Autre désignation: TMED10

Sujet: This gene is a member of the EMP24/GP25L/p24 family and encodes a protein with a GOLD domain. This type I membrane protein is localized to the plasma membrane and golgi cisternae and is involved in vesicular protein trafficking.

Poids moléculaire: 24 kDa (MW of target protein)