ACPT anticorps (Middle Region)

N° du produit ABIN635869

Détail du produit anti-ACPT anticorps

Antigène: ACPT (Acid Phosphatase, Testicular (ACPT))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACPT est non-conjugé

Application: Western Blotting (WB)

Specificité: ACPT antibody was raised against the middle region of ACPT

Purification: Affinity purified

Immunogène: ACPT antibody was raised using the middle region of ACPT corresponding to a region with amino acids TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACPT Blocking Peptide, catalog no. 33R-9175, is also available for use as a blocking control in assays to test for specificity of this ACPT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACPT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACPT

Antigène: ACPT (Acid Phosphatase, Testicular (ACPT))

Autre désignation: ACPT (ACPT Produits)

Synonymes: anticorps EG546967, anticorps Gm1432, anticorps acid phosphatase 4, anticorps ACP4, anticorps Acp4

Sujet: Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression in testicular cancer tissues than in normal tissues. ACPT has structural similarity to prostatic and lysosomal acid phosphatases.

Poids moléculaire: 43 kDa (MW of target protein)