SLC24A6 anticorps (Middle Region)
-
- Antigène Voir toutes SLC24A6 Anticorps
- SLC24A6 (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 6 (SLC24A6))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC24A6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC24 A6 antibody was raised against the middle region of SLC24 6
- Purification
- Affinity purified
- Immunogène
- SLC24 A6 antibody was raised using the middle region of SLC24 6 corresponding to a region with amino acids SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE
- Top Product
- Discover our top product SLC24A6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC24A6 Blocking Peptide, catalog no. 33R-8526, is also available for use as a blocking control in assays to test for specificity of this SLC24A6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC24A6 (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 6 (SLC24A6))
- Autre désignation
- SLC24A6 (SLC24A6 Produits)
- Synonymes
- anticorps slc24a6, anticorps NCKX6, anticorps NCLX, anticorps SLC24A6, anticorps AF261233, anticorps Slc24a6, anticorps solute carrier family 8 member B1, anticorps solute carrier family 8 (sodium/lithium/calcium exchanger), member B1, anticorps solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 S homeolog, anticorps SLC8B1, anticorps slc8b1, anticorps Slc8b1, anticorps slc8b1.S
- Sujet
- SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion.
- Poids moléculaire
- 64 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis
-