ANTXR1 anticorps (Middle Region)

N° du produit ABIN635911

Cet anticorps Lapin Polyclonal détecte spécifiquement ANTXR1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ANTXR1 anticorps (Middle Region) (ABIN635911)

Antigène: ANTXR1 (anthrax Toxin Receptor 1 (ANTXR1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANTXR1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ANTXR1 anticorps

Épitope: Middle Region

Specificité: ANTXR1 antibody was raised against the middle region of ANTXR1

Purification: Affinity purified

Immunogène: ANTXR1 antibody was raised using the middle region of ANTXR1 corresponding to a region with amino acids VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANTXR1 Blocking Peptide, (ABIN5612093), is also available for use as a blocking control in assays to test for specificity of this ANTXR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANTXR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANTXR1

Antigène: ANTXR1 (anthrax Toxin Receptor 1 (ANTXR1))

Autre désignation: ANTXR1

Sujet: ANTXR1 is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. ANTXR1 has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax.

Poids moléculaire: 60 kDa (MW of target protein)