ANTXR1 anticorps (Middle Region)

N° du produit ABIN635911

Détail du produit anti-ANTXR1 anticorps

Antigène: ANTXR1 (anthrax Toxin Receptor 1 (ANTXR1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANTXR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ANTXR1 antibody was raised against the middle region of ANTXR1

Purification: Affinity purified

Immunogène: ANTXR1 antibody was raised using the middle region of ANTXR1 corresponding to a region with amino acids VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANTXR1 Blocking Peptide, catalog no. 33R-9794, is also available for use as a blocking control in assays to test for specificity of this ANTXR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANTXR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANTXR1

Antigène: ANTXR1 (anthrax Toxin Receptor 1 (ANTXR1))

Autre désignation: ANTXR1 (ANTXR1 Produits)

Synonymes: anticorps ANTXR1, anticorps ATR, anticorps TEM8, anticorps 2310008J16Rik, anticorps 2810405N18Rik, anticorps Antrx1, anticorps Tem8, anticorps anthrax toxin receptor 1, anticorps ANTXR1, anticorps Antxr1

Sujet: ANTXR1 is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. ANTXR1 has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax.

Poids moléculaire: 60 kDa (MW of target protein)