ZIP2 anticorps

N° du produit ABIN635913

Détail du produit anti-ZIP2 anticorps

Antigène: ZIP2 (Slc39a2) (Solute Carrier Family 39 (Zinc Transporter), Member 2 (Slc39a2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZIP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC39 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC39A2 Blocking Peptide, catalog no. 33R-2468, is also available for use as a blocking control in assays to test for specificity of this SLC39A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZIP2

Antigène: ZIP2 (Slc39a2) (Solute Carrier Family 39 (Zinc Transporter), Member 2 (Slc39a2))

Autre désignation: SLC39A2 (Slc39a2 Produits)

Synonymes: anticorps 6A1, anticorps ETI-1, anticorps ZIP-2, anticorps ZIP2, anticorps F730005G13Rik, anticorps Gm1789, anticorps Gm289, anticorps Zip2, anticorps solute carrier family 39 member 2, anticorps solute carrier family 39 (zinc transporter), member 2, anticorps SLC39A2, anticorps Slc39a2

Sujet: This gene encodes a member of the ZIP family of metal ion transporters. The encoded protein functions as a zinc transporter. Mutations in this gene may be associated with susceptibility to carotid artery disease.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Autophagy