ABCB9 anticorps

N° du produit ABIN635922

Détail du produit anti-ABCB9 anticorps

Antigène: ABCB9 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 9 (ABCB9))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCB9 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ABCB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCB9 Blocking Peptide, catalog no. 33R-8059, is also available for use as a blocking control in assays to test for specificity of this ABCB9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCB9

Antigène: ABCB9 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 9 (ABCB9))

Autre désignation: ABCB9 (ABCB9 Produits)

Synonymes: anticorps ABCB9, anticorps si:dkey-21k4.3, anticorps EST122234, anticorps TAPL, anticorps mKIAA1520, anticorps Tapl, anticorps ATP binding cassette subfamily B member 9, anticorps ATP-binding cassette, sub-family B (MDR/TAP), member 9, anticorps ABCB9, anticorps abcb9, anticorps Abcb9

Sujet: ABCB9, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABCB9 is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined, however, this protein may play a role in lysosomes.

Poids moléculaire: 80 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process