ABCB9 anticorps
-
- Antigène Voir toutes ABCB9 Anticorps
- ABCB9 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 9 (ABCB9))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABCB9 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ABCB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW
- Top Product
- Discover our top product ABCB9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ABCB9 Blocking Peptide, catalog no. 33R-8059, is also available for use as a blocking control in assays to test for specificity of this ABCB9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ABCB9 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 9 (ABCB9))
- Autre désignation
- ABCB9 (ABCB9 Produits)
- Synonymes
- anticorps ABCB9, anticorps si:dkey-21k4.3, anticorps EST122234, anticorps TAPL, anticorps mKIAA1520, anticorps Tapl, anticorps ATP binding cassette subfamily B member 9, anticorps ATP-binding cassette, sub-family B (MDR/TAP), member 9, anticorps ABCB9, anticorps abcb9, anticorps Abcb9
- Sujet
- ABCB9, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABCB9 is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined, however, this protein may play a role in lysosomes.
- Poids moléculaire
- 80 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-