MBOAT7 anticorps (C-Term)
-
- Antigène Voir toutes MBOAT7 Anticorps
- MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MBOAT7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LENG4 antibody was raised against the C terminal Of Leng4
- Purification
- Affinity purified
- Immunogène
- LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA
- Top Product
- Discover our top product MBOAT7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LENG4 Blocking Peptide, catalog no. 33R-10038, is also available for use as a blocking control in assays to test for specificity of this LENG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LENG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))
- Autre désignation
- LENG4 (MBOAT7 Produits)
- Synonymes
- anticorps BB1, anticorps LENG4, anticorps LPIAT, anticorps LRC4, anticorps MBOA7, anticorps OACT7, anticorps hMBOA-7, anticorps 5730589L02Rik, anticorps Leng4, anticorps Lpiat, anticorps mBB1, anticorps RGD1306945, anticorps membrane bound O-acyltransferase domain containing 7, anticorps Lysophospholipid acyltransferase 7, anticorps MBOAT7, anticorps Mboat7, anticorps mboa-7
- Sujet
- MBOAT7 belongs to the membrane-bound acyltransferase family. It is involved in arachidonate recycling, thus regulating free arachidonic acid levels and leukotriene synthesis in neutrophils.
- Poids moléculaire
- 53 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-