SLC1A1 anticorps (N-Term)
-
- Antigène Voir toutes SLC1A1 Anticorps
- SLC1A1 (Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC1A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC1 A1 antibody was raised against the N terminal Of Slc1 1
- Purification
- Affinity purified
- Immunogène
- SLC1 A1 antibody was raised using the N terminal Of Slc1 1 corresponding to a region with amino acids VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN
- Top Product
- Discover our top product SLC1A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC1A1 Blocking Peptide, catalog no. 33R-9692, is also available for use as a blocking control in assays to test for specificity of this SLC1A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC1A1 (Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1))
- Autre désignation
- SLC1A1 (SLC1A1 Produits)
- Synonymes
- anticorps GB16911, anticorps EAAT3, anticorps SLC1A2a, anticorps zgc:91959, anticorps EAAC1, anticorps SCZD18, anticorps D130048G10Rik, anticorps EAAC2, anticorps MEAAC1, anticorps Eaac1, anticorps Eaat3, anticorps REAAC1, anticorps excitatory amino acid transporter 3, anticorps solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1, anticorps solute carrier family 1 member 1, anticorps LOC412382, anticorps slc1a1, anticorps SLC1A1, anticorps CpipJ_CPIJ000674, anticorps CpipJ_CPIJ001134, anticorps Slc1a1
- Sujet
- SLC1A1 transports L-glutamate and also L- and D-aspartate. It is essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. SLC1A1 acts as a symport by cotransporting sodium. It negatively regulated by ARL6IP5.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-