SLC24A1 anticorps
-
- Antigène Voir toutes SLC24A1 Anticorps
- SLC24A1 (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 1 (SLC24A1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC24A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC24 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSSTS
- Top Product
- Discover our top product SLC24A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC24A1 Blocking Peptide, catalog no. 33R-2672, is also available for use as a blocking control in assays to test for specificity of this SLC24A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC24A1 (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 1 (SLC24A1))
- Autre désignation
- SLC24A1 (SLC24A1 Produits)
- Synonymes
- anticorps SLC24A1, anticorps si:ch211-117i10.3, anticorps CSNB1D, anticorps HsT17412, anticorps NCKX, anticorps NCKX1, anticorps RODX, anticorps Nckx1, anticorps solute carrier family 24 (sodium/potassium/calcium exchanger), member 1, anticorps solute carrier family 24 member 1, anticorps Slc24a1, anticorps SLC24A1, anticorps slc24a1
- Sujet
- SLC24A1 belongs to a family of potassium-dependent sodium/calcium exchangers. Members of this family have 2 large hydrophilic loops and 2 sets of multiple transmembrane-spanning segments.SLC24A1 belongs to a family of potassium-dependent sodium/calcium exchangers.
- Poids moléculaire
- 121 kDa (MW of target protein)
- Pathways
- Phototransduction
-