SLC30A1 anticorps

N° du produit ABIN635943

Détail du produit anti-SLC30A1 anticorps

Antigène: SLC30A1 (Solute Carrier Family 30 (Zinc Transporter), Member 1 (SLC30A1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC30A1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC30 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC30A1 Blocking Peptide, catalog no. 33R-2860, is also available for use as a blocking control in assays to test for specificity of this SLC30A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC30A1

Antigène: SLC30A1 (Solute Carrier Family 30 (Zinc Transporter), Member 1 (SLC30A1))

Autre désignation: SLC30A1 (SLC30A1 Produits)

Synonymes: anticorps ZNT1, anticorps ZRC1, anticorps AI839647, anticorps C130040I11Rik, anticorps Znt1, anticorps ZnT1, anticorps slc30, anticorps MGC53047, anticorps XZnSLC30, anticorps slc30a1, anticorps zgc:77589, anticorps zrc1, anticorps ZnT-1, anticorps ZNT8, anticorps ZnT-8, anticorps zinc transporter 1 precursor, anticorps RGD1305098, anticorps zgc:162909, anticorps znt1, anticorps solute carrier family 30 member 1, anticorps solute carrier family 30 (zinc transporter), member 1, anticorps solute carrier family 30 member 1 L homeolog, anticorps solute carrier family 30 (zinc transporter), member 1a, anticorps solute carrier family 30 member 8, anticorps zinc transporter 1 precursor, anticorps solute carrier family 30, member 10, anticorps solute carrier family 30 (zinc transporter), member 1b, anticorps SLC30A1, anticorps Slc30a1, anticorps slc30a1.L, anticorps slc30a1a, anticorps slc30a1, anticorps SLC30A8, anticorps ZIP1, anticorps Slc30a10, anticorps slc30a1b

Sujet: SLC30A1 may be involved in zinc transport out of the cell.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis