LRP8 anticorps (Middle Region)

N° du produit ABIN635949

Détail du produit anti-LRP8 anticorps

Antigène: LRP8 (Low Density Lipoprotein Receptor-Related Protein 8, Apolipoprotein E Receptor (LRP8))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRP8 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRP8 antibody was raised against the middle region of LRP8

Purification: Affinity purified

Immunogène: LRP8 antibody was raised using the middle region of LRP8 corresponding to a region with amino acids ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRP8 Blocking Peptide, catalog no. 33R-1575, is also available for use as a blocking control in assays to test for specificity of this LRP8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRP8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRP8

Antigène: LRP8 (Low Density Lipoprotein Receptor-Related Protein 8, Apolipoprotein E Receptor (LRP8))

Autre désignation: LRP8 (LRP8 Produits)

Synonymes: anticorps LRP8, anticorps APOER2, anticorps HSZ75190, anticorps LRP-8, anticorps MCI1, anticorps 4932703M08Rik, anticorps AA921429, anticorps AI848122, anticorps ApoER2, anticorps Lr8b, anticorps LR8B, anticorps LDL receptor related protein 8, anticorps low density lipoprotein receptor-related protein 8, apolipoprotein e receptor, anticorps LRP8, anticorps Lrp8

Sujet: LRP8 is an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL).

Poids moléculaire: 74 kDa (MW of target protein)