GZMK anticorps

N° du produit ABIN635952

Détail du produit anti-GZMK anticorps

Antigène: GZMK (Granzyme K (Granzyme 3, Tryptase II) (GZMK))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GZMK est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Granzyme K antibody was raised using a synthetic peptide corresponding to a region with amino acids LRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Granzyme K Blocking Peptide, catalog no. 33R-5391, is also available for use as a blocking control in assays to test for specificity of this Granzyme K antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GZMK

Antigène: GZMK (Granzyme K (Granzyme 3, Tryptase II) (GZMK))

Autre désignation: Granzyme K (GZMK Produits)

Synonymes: anticorps TRYP2, anticorps granzyme K, anticorps GZMK, anticorps Gzmk

Sujet: GZMK is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells.

Poids moléculaire: 26 kDa (MW of target protein)