Oncostatin M Receptor anticorps (Middle Region)

N° du produit ABIN635958

Détail du produit anti-Oncostatin M Receptor anticorps

Antigène: Oncostatin M Receptor (OSMR)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Oncostatin M Receptor est non-conjugé

Application: Western Blotting (WB)

Specificité: OSMR antibody was raised against the middle region of OSMR

Purification: Affinity purified

Immunogène: OSMR antibody was raised using the middle region of OSMR corresponding to a region with amino acids LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OSMR Blocking Peptide, catalog no. 33R-5130, is also available for use as a blocking control in assays to test for specificity of this OSMR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSMR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Oncostatin M Receptor

Antigène: Oncostatin M Receptor (OSMR)

Autre désignation: OSMR (OSMR Produits)

Synonymes: anticorps OSMRB, anticorps PLCA1, anticorps oncostatin M receptor, anticorps OSMR, anticorps Osmr

Sujet: Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells.

Poids moléculaire: 110 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Growth Factor Binding