A4GALT anticorps
-
- Antigène Voir toutes A4GALT Anticorps
- A4GALT (alpha 1, 4-Galactosyltransferase (A4GALT))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp A4GALT est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- A4 GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE
- Top Product
- Discover our top product A4GALT Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
A4GALT Blocking Peptide, catalog no. 33R-7959, is also available for use as a blocking control in assays to test for specificity of this A4GALT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 ALT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- A4GALT (alpha 1, 4-Galactosyltransferase (A4GALT))
- Autre désignation
- A4GALT (A4GALT Produits)
- Synonymes
- anticorps A14GALT, anticorps A4GALT1, anticorps Gb3S, anticorps P(k), anticorps P1, anticorps P1PK, anticorps PK, anticorps Gb3, anticorps alpha 1,4-galactosyltransferase (P blood group), anticorps alpha 1,4-galactosyltransferase, anticorps A4GALT, anticorps A4galt
- Sujet
- The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system.
- Poids moléculaire
- 40 kDa (MW of target protein)
-