TM4SF4 anticorps (N-Term)

N° du produit ABIN636043

Détail du produit anti-TM4SF4 anticorps

Antigène: TM4SF4 (Transmembrane 4 Superfamily Member 4 (TM4SF4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TM4SF4 est non-conjugé

Application: Western Blotting (WB)

Specificité: TM4 SF4 antibody was raised against the N terminal of TM4 F4

Purification: Affinity purified

Immunogène: TM4 SF4 antibody was raised using the N terminal of TM4 F4 corresponding to a region with amino acids CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TM4SF4 Blocking Peptide, catalog no. 33R-1822, is also available for use as a blocking control in assays to test for specificity of this TM4SF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TM4SF4

Antigène: TM4SF4 (Transmembrane 4 Superfamily Member 4 (TM4SF4))

Autre désignation: TM4SF4 (TM4SF4 Produits)

Synonymes: anticorps ILTMP, anticorps il-TMP, anticorps Lrtm4, anticorps Iltmp, anticorps transmembrane 4 L six family member 4, anticorps transmembrane 4 superfamily member 4, anticorps TM4SF4, anticorps Tm4sf4

Sujet: TM4SF4 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that can regulate cell proliferation.

Poids moléculaire: 21 kDa (MW of target protein)