SLC27A5 anticorps
-
- Antigène Voir toutes SLC27A5 Anticorps
- SLC27A5 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC27A5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC27 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD
- Top Product
- Discover our top product SLC27A5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC27A5 Blocking Peptide, catalog no. 33R-4549, is also available for use as a blocking control in assays to test for specificity of this SLC27A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC27A5 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5))
- Autre désignation
- SLC27A5 (SLC27A5 Produits)
- Synonymes
- anticorps ACSB, anticorps ACSVL6, anticorps BACS, anticorps BAL, anticorps FACVL3, anticorps FATP-5, anticorps FATP5, anticorps VLACSR, anticorps VLCS-H2, anticorps VLCSH2, anticorps Vlacsr, anticorps rBAL-1, anticorps SLC27A5, anticorps solute carrier family 27 member 5, anticorps solute carrier family 27 (fatty acid transporter), member 5, anticorps bile acyl-CoA synthetase, anticorps SLC27A5, anticorps Slc27a5, anticorps LOC608675, anticorps LOC100450572
- Sujet
- The protein encoded by this gene is an isozyme of very long-chain acyl-CoA synthetase (VLCS). It is capable of activating very long-chain fatty-acids containing 24- and 26-carbons.
- Poids moléculaire
- 75 kDa (MW of target protein)
-