CYP4B1 anticorps (N-Term)

N° du produit ABIN636076

Détail du produit anti-CYP4B1 anticorps

Antigène: CYP4B1 (Cytochrome P450, Family 4, Subfamily B, Polypeptide 1 (CYP4B1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP4B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP4 B1 antibody was raised against the N terminal of CYP4 1

Purification: Affinity purified

Immunogène: CYP4 B1 antibody was raised using the N terminal of CYP4 1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP4B1 Blocking Peptide, catalog no. 33R-8937, is also available for use as a blocking control in assays to test for specificity of this CYP4B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP4B1

Antigène: CYP4B1 (Cytochrome P450, Family 4, Subfamily B, Polypeptide 1 (CYP4B1))

Autre désignation: CYP4B1 (CYP4B1 Produits)

Synonymes: anticorps CYPIVB1, anticorps P-450HP, anticorps cytochrome P450, family 4, subfamily B, polypeptide 1, anticorps CYP4B1-like isozyme short form, anticorps cytochrome P450, family 4, subfamily B, polypeptide 1 L homeolog, anticorps cytochrome P450 family 4 subfamily B member 1, anticorps cytochrome P450, family 4, subfamily b, polypeptide 1, anticorps cytochrome P450 family 4 subfamily B member 1 L homeolog, anticorps CYP4B1, anticorps cyp4b1.L, anticorps cyp4b1, anticorps Cyp4b1, anticorps cyp4b1.2.L

Sujet: CYP4B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens, however, the specific function of the human protein has not been determined.

Poids moléculaire: 59 kDa (MW of target protein)