SLC22A7 anticorps
-
- Antigène Voir toutes SLC22A7 Anticorps
- SLC22A7 (Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC22A7 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC22 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDH
- Top Product
- Discover our top product SLC22A7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC22A7 Blocking Peptide, catalog no. 33R-2626, is also available for use as a blocking control in assays to test for specificity of this SLC22A7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC22A7 (Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7))
- Autre désignation
- SLC22A7 (SLC22A7 Produits)
- Synonymes
- anticorps NLT, anticorps OAT2, anticorps Oat2, anticorps oat2, anticorps nlt, anticorps slc22a7, anticorps im:6901703, anticorps im:7155670, anticorps oat2a, anticorps zgc:162334, anticorps oat2e, anticorps slc22a7b, anticorps zgc:63958, anticorps solute carrier family 22 member 7, anticorps solute carrier family 22 (organic anion transporter), member 7, anticorps solute carrier family 22 (organic anion transporter), member 7 L homeolog, anticorps solute carrier family 22 (organic anion transporter), member 7a, anticorps solute carrier family 22 (organic anion transporter), member 7b, tandem duplicate 1, anticorps SLC22A7, anticorps Slc22a7, anticorps slc22a7.L, anticorps slc22a7a, anticorps slc22a7b.1
- Sujet
- SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.
- Poids moléculaire
- 60 kDa (MW of target protein)
-