ILDR1 anticorps (Middle Region)
-
- Antigène Voir toutes ILDR1 Anticorps
- ILDR1 (Immunoglobulin-Like Domain Containing Receptor 1 (ILDR1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ILDR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ILDR1 antibody was raised against the middle region of ILDR1
- Purification
- Affinity purified
- Immunogène
- ILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV
- Top Product
- Discover our top product ILDR1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ILDR1 Blocking Peptide, catalog no. 33R-8140, is also available for use as a blocking control in assays to test for specificity of this ILDR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ILDR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ILDR1 (Immunoglobulin-Like Domain Containing Receptor 1 (ILDR1))
- Autre désignation
- ILDR1 (ILDR1 Produits)
- Synonymes
- anticorps DFNB42, anticorps ILDR1alpha, anticorps ILDR1alpha', anticorps ILDR1beta, anticorps AU041483, anticorps AU044638, anticorps RGD1307792, anticorps immunoglobulin like domain containing receptor 1, anticorps immunoglobulin-like domain containing receptor 1, anticorps immunoglobulin-like domain containing receptor 1 L homeolog, anticorps ILDR1, anticorps Ildr1, anticorps ildr1.L
- Sujet
- ILDR1 is a putative membrane receptor.
- Poids moléculaire
- 58 kDa (MW of target protein)
-