TSPAN33 anticorps (Middle Region)

N° du produit ABIN636117

Détail du produit anti-TSPAN33 anticorps

Antigène: TSPAN33 (Tetraspanin 33 (TSPAN33))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSPAN33 est non-conjugé

Application: Western Blotting (WB)

Specificité: Tetraspanin 33 antibody was raised against the middle region of TSPAN33

Purification: Affinity purified

Immunogène: Tetraspanin 33 antibody was raised using the middle region of TSPAN33 corresponding to a region with amino acids LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 33 Blocking Peptide, catalog no. 33R-5321, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSPAN33

Antigène: TSPAN33 (Tetraspanin 33 (TSPAN33))

Autre désignation: Tetraspanin 33 (TSPAN33 Produits)

Synonymes: anticorps zgc:92266, anticorps PEN, anticorps 1300010A20Rik, anticorps AI035228, anticorps Pen, anticorps RGD1560915, anticorps tetraspanin 33, anticorps tetraspanin 33a, anticorps tetraspanin 33 L homeolog, anticorps TSPAN33, anticorps tspan33a, anticorps tspan33.L, anticorps Tspan33

Sujet: TSPAN33 plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.

Poids moléculaire: 31 kDa (MW of target protein)