TSPAN33 anticorps (Middle Region)

N° du produit ABIN636117

Cet anticorps anti-TSPAN33 Polyclonal Lapin (ABIN636117) détecte spécifiquement TSPAN33 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TSPAN33 anticorps (Middle Region) (ABIN636117)

Antigène: TSPAN33 (Tetraspanin 33 (TSPAN33))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSPAN33 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TSPAN33 anticorps

Épitope: Middle Region

Specificité: Tetraspanin 33 antibody was raised against the middle region of TSPAN33

Purification: Affinity purified

Immunogène: Tetraspanin 33 antibody was raised using the middle region of TSPAN33 corresponding to a region with amino acids LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 33 Blocking Peptide, (ABIN5616558), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSPAN33

Antigène: TSPAN33 (Tetraspanin 33 (TSPAN33))

Autre désignation: Tetraspanin 33

Sujet: TSPAN33 plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.

Poids moléculaire: 31 kDa (MW of target protein)