TNFRSF21 anticorps (N-Term)

N° du produit ABIN636122

Détail du produit anti-TNFRSF21 anticorps

Antigène: TNFRSF21 (Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNFRSF21 est non-conjugé

Application: Western Blotting (WB)

Specificité: TNFRSF21 antibody was raised against the N terminal of TNFRSF21

Purification: Affinity purified

Immunogène: TNFRSF21 antibody was raised using the N terminal of TNFRSF21 corresponding to a region with amino acids TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TNFRSF21 Blocking Peptide, catalog no. 33R-9334, is also available for use as a blocking control in assays to test for specificity of this TNFRSF21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFRSF21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNFRSF21

Antigène: TNFRSF21 (Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21))

Autre désignation: TNFRSF21 (TNFRSF21 Produits)

Synonymes: anticorps TNFRSF21, anticorps tnfrsf21, anticorps MGC146356, anticorps BM-018, anticorps CD358, anticorps DR6, anticorps AA959878, anticorps R74815, anticorps TR7, anticorps dr6, anticorps im:6795346, anticorps wu:fa55e01, anticorps wu:fb02e11, anticorps wu:fc29a09, anticorps wu:fi27h08, anticorps TNF receptor superfamily member 21, anticorps tumor necrosis factor receptor superfamily member 21, anticorps tumor necrosis factor receptor superfamily, member 21, anticorps TNFRSF21, anticorps tnfrsf21, anticorps Tnfrsf21

Sujet: TNFRSF21 is a member of the TNF-receptor superfamily. This receptor has been shown to activateNF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction ofTNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha