BCAP29 anticorps (Middle Region)

N° du produit ABIN636123

Détail du produit anti-BCAP29 anticorps

Antigène: BCAP29 (B-Cell Receptor-Associated Protein 29 (BCAP29))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BCAP29 est non-conjugé

Application: Western Blotting (WB)

Specificité: BCAP29 antibody was raised against the middle region of BCAP29

Purification: Affinity purified

Immunogène: BCAP29 antibody was raised using the middle region of BCAP29 corresponding to a region with amino acids GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BCAP29 Blocking Peptide, catalog no. 33R-3644, is also available for use as a blocking control in assays to test for specificity of this BCAP29 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAP29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BCAP29

Antigène: BCAP29 (B-Cell Receptor-Associated Protein 29 (BCAP29))

Autre désignation: BCAP29 (BCAP29 Produits)

Synonymes: anticorps AW208404, anticorps Bap29, anticorps BAP29, anticorps B-cell receptor associated protein 29, anticorps B cell receptor associated protein 29, anticorps B-cell receptor-associated protein 29, anticorps BCAP29, anticorps Bcap29

Sujet: BCAP29 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. BCAP29 may be involved in CASP8-mediated apoptosis.

Poids moléculaire: 39 kDa (MW of target protein)