DDT anticorps

N° du produit ABIN6719479

Détail du produit anti-DDT anticorps

Antigène: DDT (D-Dopachrome Tautomerase (DDT))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDT est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for DDT detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: EFLTKELALG QDRILIRFFP LESWQIGKIG TVMTFL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for DDT detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human DDT (EFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL).

Isotype: IgG

Information d'application

Indications d'application:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL

Commentaires:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur DDT

Antigène: DDT (D-Dopachrome Tautomerase (DDT))

Autre désignation: DDT (DDT Produits)

Synonymes: anticorps ddt-b, anticorps zgc:86714, anticorps wu:fb49f11, anticorps C78655, anticorps DDT, anticorps ddt, anticorps ddt-a, anticorps DDCT, anticorps D-dopachrome tautomerase L homeolog, anticorps D-dopachrome tautomerase, anticorps D-dopachrome tautomerase S homeolog, anticorps ddt.L, anticorps DDT, anticorps ddt, anticorps Ddt, anticorps ddt.S

Sujet:

Synonyms: D-dopachrome decarboxylase, D-dopachrome tautomerase, Phenylpyruvate tautomerase II, DDT

Background: DDT, D-dopachrome tautomerization, converts D-dopachrome into 5, 6-dihydroxyindole. Northern blot analysis revealed that DDT was expressed as a 0.6-kb mRNA in all tissues tested, with the strongest expression in liver. The DDT gene in human and mouse is identical in exon structure to the MIF gene. Both genes have 2 introns that are located at equivalent positions, relative to a 2-fold repeat in protein structure.the genes for DDT and MIF are closely linked on human chromosome 22 and mouse chromosome 10.

ID gène: 1652

UniProt: P30046