DDT anticorps
-
- Antigène Voir toutes DDT Anticorps
- DDT (D-Dopachrome Tautomerase (DDT))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DDT est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for DDT detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- EFLTKELALG QDRILIRFFP LESWQIGKIG TVMTFL
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for DDT detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence of human DDT (EFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL).
- Isotype
- IgG
- Top Product
- Discover our top product DDT Anticorps primaire
-
-
- Indications d'application
-
Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL
- Commentaires
-
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- DDT (D-Dopachrome Tautomerase (DDT))
- Autre désignation
- DDT (DDT Produits)
- Synonymes
- anticorps ddt-b, anticorps zgc:86714, anticorps wu:fb49f11, anticorps C78655, anticorps DDT, anticorps ddt, anticorps ddt-a, anticorps DDCT, anticorps D-dopachrome tautomerase L homeolog, anticorps D-dopachrome tautomerase, anticorps D-dopachrome tautomerase S homeolog, anticorps ddt.L, anticorps DDT, anticorps ddt, anticorps Ddt, anticorps ddt.S
- Sujet
-
Synonyms: D-dopachrome decarboxylase, D-dopachrome tautomerase, Phenylpyruvate tautomerase II, DDT
Background: DDT, D-dopachrome tautomerization, converts D-dopachrome into 5, 6-dihydroxyindole. Northern blot analysis revealed that DDT was expressed as a 0.6-kb mRNA in all tissues tested, with the strongest expression in liver. The DDT gene in human and mouse is identical in exon structure to the MIF gene. Both genes have 2 introns that are located at equivalent positions, relative to a 2-fold repeat in protein structure.the genes for DDT and MIF are closely linked on human chromosome 22 and mouse chromosome 10.
- ID gène
- 1652
- UniProt
- P30046
-