CLEC9A anticorps

N° du produit ABIN6719546

Détail du produit anti-CLEC9A anticorps

Antigène: CLEC9A (C-Type Lectin Domain Family 9, Member A (CLEC9A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLEC9A est non-conjugé

Application: Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Fonction: Rabbit IgG polyclonal antibody for CLEC9A detection. Tested with IHC-F, ICC, FCM in Human.

Séquence: EIWSIWHTSQ ENCLKEGSTL LQIESKEEMD FITGSLRKIK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for CLEC9A detection. Tested with IHC-F, ICC, FCM in Human.

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human CLEC9A (EIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIK).

Isotype: IgG

Information d'application

Indications d'application:

Application details: Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Commentaires:

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur CLEC9A

Antigène: CLEC9A (C-Type Lectin Domain Family 9, Member A (CLEC9A))

Autre désignation: CLEC9A (CLEC9A Produits)

Synonymes: anticorps 9830005G06Rik, anticorps DNGR-1, anticorps DNGR1, anticorps UNQ9341, anticorps RGD1562513, anticorps C-type lectin domain family 9, member a, anticorps C-type lectin domain containing 9A, anticorps C-type lectin domain family 9, member A, anticorps Clec9a, anticorps CLEC9A

Sujet:

Synonyms: C-type lectin domain family 9 member A, CLEC9A, UNQ9341/PRO34046

Background: C-type lectin domain family 9 member A is a protein that in humans is encoded by the CLEC9A gene. CLEC9A is a group V C-type lectin-like receptor (CTLR) that functions as an activation receptor and is expressed on myeloid lineage cells. By genomic sequence analysis, this gene is mapped to chromosome 12p13.31, centromeric to CLEC12B (617573) and telomeric to CLEC1A (606782).

ID gène: 283420