SCN4B anticorps

N° du produit ABIN6719653

Détail du produit anti-SCN4B anticorps

Antigène: SCN4B (Sodium Channel, Voltage-Gated, Type IV, beta Subunit (SCN4B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCN4B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for SCN4B detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: LRDLEFSDTG KYTCHVKNPK ENNLQHHATI FLQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for SCN4B detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human SCN4B (LRDLEFSDTGKYTCHVKNPKENNLQHHATIFLQ).

Isotype: IgG

Information d'application

Indications d'application:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL

Commentaires:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SCN4B

Antigène: SCN4B (Sodium Channel, Voltage-Gated, Type IV, beta Subunit (SCN4B))

Autre désignation: SCN4B (SCN4B Produits)

Synonymes: anticorps LQT10, anticorps Navbeta4, anticorps Gm1471, anticorps sb:cb973, anticorps scn4b.2, anticorps si:ch211-139a5.5, anticorps scn4b.1, anticorps scn4b1, anticorps zgc:165389, anticorps sodium voltage-gated channel beta subunit 4, anticorps sodium channel, type IV, beta, anticorps sodium channel, voltage-gated, type IV, beta b, anticorps sodium channel, voltage-gated, type IV, beta a, anticorps SCN4B, anticorps Scn4b, anticorps scn4bb, anticorps scn4ba

Sujet:

Synonyms: Sodium channel subunit beta-4, SCN4B

Background: Sodium channel β-subunit 4, also known as SCN4B or Naβ4, is a protein that in humans is encoded by the SCN4B gene. The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.

ID gène: 6330