ZNF566 anticorps (Internal Region)
-
- Antigène Voir toutes ZNF566 Anticorps
- ZNF566 (Zinc Finger Protein 566 (ZNF566))
-
Épitope
- Internal Region
-
Reactivité
- Humain, Cheval, Rat, Cobaye, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZNF566 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Rat Zpf566
- Purification
- Immunoaffinity purified
- Immunogène
-
The immunogen for anti-Zfp566 antibody: synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI. Percent identity by BLAST analysis: Rat, Horse, Human, Mouse (100%), Dog, Pig, Bovine, Rabbit, Zebrafish (93%), Guinea pig (86%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product ZNF566 Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Commentaires
-
Target Species of Antibody: Rat
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Distilled water
- Concentration
- Lot specific
- Buffer
- Lyophilized from PBS, 2 % sucrose.
- Conseil sur la manipulation
- Avoid freeze-thaw cycles.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
-
- Antigène
- ZNF566 (Zinc Finger Protein 566 (ZNF566))
- Autre désignation
- Zfp566 (ZNF566 Produits)
- Synonymes
- anticorps ZNF420, anticorps RGD1563239, anticorps zinc finger protein 566, anticorps ZNF566, anticorps Zfp566
- Sujet
-
Name/Gene ID: Zfp566
Synonyms: Zfp566 - ID gène
- 502316
-