GADD34 anticorps

N° du produit ABIN7882079

Cet anticorps anti-GADD34 Polyclonal Lapin (ABIN7882079) détecte spécifiquement GADD34 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour GADD34 anticorps (ABIN7882079)

Antigène: GADD34 (PPP1R15A) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 15A (PPP1R15A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GADD34 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GADD34 anticorps

Fonction: GADD34 Antibody / PPP1R15A

Séquence: MAPGQAPHQA TPWRDAHPFF LLSPVMGLLS RAWSRLR

Purification: Antigen affinity purified

Immunogène: Amino acids MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLR were used as the immunogen for the GADD34 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the GADD34 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the GADD34 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur GADD34

Antigène: GADD34 (PPP1R15A) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 15A (PPP1R15A))

Autre désignation: GADD34

Sujet: Protein phosphatase 1 regulatory subunit 15A also known as growth arrest and DNA damage-inducible protein GADD34 is a protein that in humans is encoded by the PPP1R15A gene.

UniProt: O75807

Pathways: ER-Nucleus Signaling, Unfolded Protein Response