anti-Humain Versican anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended Versican Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Versican (Vcan) Anticorps
  • br146
  • cspg2
  • cspg2a
  • sb:cb63
  • versican
  • CSPG2
  • Cspg2
  • wgn
  • ervr
  • pg-m
  • wgn1
  • Xversican
  • dcan
  • cspg2b
  • fb99b07
  • wu:fb99b07
  • ERVR
  • GHAP
  • PG-M
  • WGN
  • WGN1
  • 5430420N07Rik
  • 9430051N09
  • DPEAAE
  • NG2
  • PG-M(V0)
  • PG-M(V1)
  • hdf
  • versican a
  • versican
  • versican b
  • vcana
  • VCAN
  • Vcan
  • vcan
  • vcanb
Reactivité
Humain
100
76
75
7
3
3
1
1
1
1
1
1
Hôte
Lapin
92
38
2
1
Clonalité
Polyclonal
Conjugué
Inconjugué
6
5
4
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
111
70
36
16
15
13
13
6
2
1
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4365244
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
12.35866 ABIN741660 IF (p) IHC (p) Rabbit IgG AA 3360-3395 Connectez-vous pour afficher Polyclonal 0
1 ABIN3043957 IHC (p) WB Rabbit IgG AA 65-92, N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN3044147 IHC (p) WB Rabbit IgG AA 3314-3333, C-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN741669 IHC (p) HRP Rabbit IgG AA 3360-3395 Connectez-vous pour afficher Polyclonal 0
1 ABIN2629810 IHC IHC (p) WB Rabbit IgG AA 3314-3333 Connectez-vous pour afficher Polyclonal 0
1 ABIN741662 IHC (p) Biotin Rabbit IgG AA 3360-3395 Connectez-vous pour afficher Polyclonal 0
1 ABIN4902448 ELISA IHC (p) Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN3029587 IHC (p) WB Rabbit IgG AA 3314-3333 Connectez-vous pour afficher Polyclonal 0
1 ABIN2154598 IHC (p) WB Rabbit IgG C-Term, AA 3314-333 Connectez-vous pour afficher Polyclonal 0
1 ABIN5590699 IF IHC (p) Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN4953064 IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène Versican (Vcan) Anticorps
Reactivité Humain
(100), (76), (75), (7), (3), (3), (1), (1), (1), (1), (1), (1)
Hôte Lapin
(92), (38), (2), (1)
Clonalité
Polyclonal
Conjugué Inconjugué
(6), (5), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(111), (70), (36), (16), (15), (13), (13), (6), (2), (1), (1), (1)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Référence Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Référence Images Haut de la page
Antigène
Autre désignation Versican (Vcan Antibody Extrait)
Sujet Gene Symbol: VCAN
ID gène 1462
UniProt P13611
Pathways Glycosaminoglycan Metabolic Process

Information d'application

Détail du produit Détail du antigène Stockage Référence Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500Immunohistochemistry retrieval recommended: HIER pH 6
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Référence Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Référence

Détail du produit Détail du antigène Information d'application Stockage Images Haut de la page
Produit citée dans:

Van Bockstal, Lambein, Van Gele, De Vlieghere, Limame, Braems, Van den Broecke, Cocquyt, Denys, Bracke, Libbrecht, De Wever: "Differential regulation of extracellular matrix protein expression in carcinoma-associated fibroblasts by TGF-β1 regulates cancer cell spreading but not adhesion." dans: Oncoscience, Vol. 1, Issue 10, pp. 634-48, 2015 (Échantillon (espèces): Human). Détails: Immunohistochemistry

Images

Détail du produit Détail du antigène Information d'application Stockage Référence Haut de la page
Images (Fournisseur)
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Versican (Vcan) antibody (ABIN4365244) Immunohistochemistry-Paraffin: Versican Antibody - Staining of human tonsil shows no...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Versican (Vcan) antibody (ABIN4365244) Immunohistochemistry-Paraffin: Versican Antibody - Staining of human uterine cervix ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Versican (Vcan) antibody (ABIN4365244) Immunohistochemistry-Paraffin: Versican Antibody - Staining of human stomach shows m...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Versican (Vcan) antibody (ABIN4365244) Immunohistochemistry-Paraffin: Versican Antibody - Staining of human cerebral cortex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Versican (Vcan) antibody (ABIN4365244) Immunohistochemistry-Paraffin: Versican Antibody - Staining of human cerebral cortex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Versican (Vcan) antibody (ABIN4365244) Immunohistochemistry-Paraffin: Versican Antibody - Staining in human cerebral cortex...