anti-Humain Regulator of G-Protein Signaling 9 anticorps pour Western Blotting

Recommended Regulator of G-Protein Signaling 9 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Regulator of G-Protein Signaling 9 (RGS) Anticorps
  • LOC100218209
  • RGS9-1
  • Rgs9-2
  • PERRS
  • RGS9L
  • regulator of G-protein signaling 9
  • regulator of G protein signaling 9
  • RGS9
  • Tsp_08067
  • Rgs9
Épitope
N-Term
12
11
7
4
3
3
2
2
1
1
Reactivité
Humain, Souris, Rat (Rattus), Chien
45
17
13
4
3
3
2
2
2
1
Hôte
Lapin
46
3
Clonalité
Polyclonal
Conjugué
Inconjugué
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Western Blotting (WB)
47
26
24
7
2
2
2
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN630222
$ 437.50
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
12.755681 ABIN634416 WB Rabbit Middle Region Connectez-vous pour afficher Polyclonal 0
12.755681 ABIN2150580 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
12.755681 ABIN6146930 WB Rabbit Connectez-vous pour afficher Polyclonal 0
7.8026123 ABIN2792222 IHC WB Rabbit N-Term Connectez-vous pour afficher Polyclonal 1
7.8026123 ABIN5586995 IHC (p) WB Rabbit Connectez-vous pour afficher Polyclonal 0
7.8026123 ABIN5014265 ICC IHC WB Rabbit IgG AA 1-296 Connectez-vous pour afficher Polyclonal 0
7.8026123 ABIN2997834 IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
7.8026123 ABIN6001488 IF/ICC IHC IP WB Rabbit AA 1-296 Connectez-vous pour afficher Polyclonal 0
7 ABIN202538 IHC IHC (p) WB Rabbit IgG AA 230-279 Connectez-vous pour afficher Polyclonal 0
7 ABIN5532989 IHC (p) WB Rabbit Ig Fraction AA 149-178, N-Term Connectez-vous pour afficher Polyclonal 0
4.8026123 ABIN2779303 WB Rabbit Middle Region Connectez-vous pour afficher Polyclonal 1
4.8026123 ABIN658157 IHC (p) WB Rabbit Ig Fraction AA 149-178, N-Term Connectez-vous pour afficher Polyclonal 0
4.8026123 ABIN6264728 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
4.8026123 ABIN3042642 WB Rabbit IgG AA 624-638, C-Term Connectez-vous pour afficher Polyclonal 0
4.8026123 ABIN2467889 WB Chicken AA 21-200 Connectez-vous pour afficher Polyclonal 0
4.8026123 ABIN3032456 WB Rabbit IgG C-Term Connectez-vous pour afficher Polyclonal 0
4 ABIN477318 WB Rabbit IgG C-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN2627630 WB Rabbit IgG AA 624-638 Connectez-vous pour afficher Polyclonal 0
1 ABIN295409 ELISA WB Chicken IgY AA 21-200 Connectez-vous pour afficher Polyclonal 0
1 ABIN2351169 IHC ELISA WB Rabbit IgG N-Term, AA 148-178 Connectez-vous pour afficher Polyclonal 0

General

Antigène Regulator of G-Protein Signaling 9 (RGS) Anticorps
Épitope N-Term
(12), (11), (7), (4), (3), (3), (2), (2), (1), (1)
Reactivité Humain, Souris, Rat (Rattus), Chien
(45), (17), (13), (4), (3), (3), (2), (2), (2), (1)
Hôte Lapin
(46), (3)
Clonalité
Polyclonal
Conjugué Inconjugué
(2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(47), (26), (24), (7), (2), (2), (2)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Specificité RGS9 antibody was raised against the N terminal of RGS9
Purification Purified
Immunogène RGS9 antibody was raised using the N terminal of RGS9 corresponding to a region with amino acids MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Antigène
Autre désignation RGS9 (RGS Antibody Extrait)
Sujet RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation.
Poids moléculaire 49 kDa (MW of target protein)
Pathways Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Phototransduction

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Commentaires

RGS9 Blocking Peptide, catalog no. 33R-6633, is also available for use as a blocking control in assays to test for specificity of this RGS9 antibody

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS9 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-Regulator of G-Protein Signaling 9 (RGS) (N-Term) antibody (ABIN630222) RGS9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to st...
Western Blotting (WB) image for anti-Regulator of G-Protein Signaling 9 (RGS) (N-Term) antibody (ABIN630222) RGS9 antibody used at 2 ug/ml to detect target protein.