anti-Humain RP2 anticorps pour Immunocytochemistry

Recommended RP2 Antibody

Antigène
Retinitis Pigmentosa 2 (X-Linked Recessive) (RP2) Anticorps
  • Rp2h
  • RGD1565124
  • RP2
  • wu:fj10e02
  • wu:fm72d05
  • zfrp2
  • zgc:55632
  • DELXp11.3
  • NM23-H10
  • NME10
  • TBCCD2
  • XRP2
  • AI662636
  • Rp2
  • RP2, ARL3 GTPase activating protein
  • XRP2 protein
  • XRP2-like protein
  • retinitis pigmentosa 2 (X-linked recessive)
  • RP2, ARL3 GTPase activating protein S homeolog
  • retinitis pigmentosa 2 homolog
  • Rp2
  • RP2
  • Bm1_36735
  • PITG_13367
  • LOAG_11813
  • rp2
  • rp2.S
Reactivité
Humain
22
8
8
2
2
1
1
1
1
Hôte
Lapin
14
8
Clonalité
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
21
13
7
3
2
1
1
1
Options

Images

N° du produit ABIN5079384
Produit non disponible pour cette région.

General

Antigène Retinitis Pigmentosa 2 (X-Linked Recessive) (RP2) Anticorps
Reactivité Humain
(22), (8), (8), (2), (2), (1), (1), (1), (1)
Hôte Lapin
(14), (8)
Clonalité
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(21), (13), (7), (3), (2), (1), (1), (1)
Fournisseur

Détail du produit anti-RP2 anticorps

Détail du antigène RP2 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALE
Isotype IgG
Plasmids, Primers & others

Détail du antigène RP2

Détail du produit anti-RP2 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation RP2 (RP2 Antibody Extrait)
Sujet Gene Symbol: RP2
ID gène 6102
Pathways Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process

Information d'application

Détail du produit anti-RP2 anticorps Détail du antigène RP2 Stockage Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-RP2 anticorps Détail du antigène RP2 Information d'application Images Haut de la page
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-RP2 anticorps Détail du antigène RP2 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Retinitis Pigmentosa 2 (X-Linked Recessive) (RP2) antibody (ABIN5079384) Immunocytochemistry/Immunofluorescence: RP2 Antibody - Staining of human cell line U...
Western Blotting (WB) image for anti-Retinitis Pigmentosa 2 (X-Linked Recessive) (RP2) antibody (ABIN5079384) Western Blot: RP2 Antibody - Western blot analysis in human cell line RT-4.