BMI1 Protein (AA 1-250, partial) (GST tag)
-
- Antigène Voir toutes BMI1 Protéines
- BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))
- Type de proteíne
- Recombinant
- Attributs du protein
- AA 1-250, partial
-
Origine
- Humain
-
Source
- Escherichia coli (E. coli)
- Purification/Conjugué
- Cette BMI1 protéine est marqué à la GST tag.
- Application
- Western Blotting (WB), SDS-PAGE (SDS), ELISA
- Séquence
- MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCK TCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVY KLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVND KRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPL KDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR DGLTNAGELE
- Pureté
- 95 %
- Top Product
- Discover our top product BMI1 Protéine
-
-
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Buffer
- 6M guanidine hydrochloride, 20mM Tris
- Stock
- 4 °C
-
- Antigène
- BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))
- Autre désignation
- Polycomb complex protein BMI-1 (BMI1 Produits)
- Synonymes
- FLVI2/BMI1 Protein, PCGF4 Protein, RNF51 Protein, AW546694 Protein, Bmi-1 Protein, Pcgf4 Protein, bmi1 Protein, pcgf4 Protein, psc1 Protein, wu:fb17g03 Protein, wu:fd18f06 Protein, BMI-1 Protein, pcgf4b Protein, bmi-1 Protein, bmi1-a Protein, bmi1-b Protein, bmi1b Protein, rnf51 Protein, xbmi-1 Protein, BMI1 proto-oncogene, polycomb ring finger Protein, BMI1 polycomb ring finger oncogene Protein, Bmi1 polycomb ring finger oncogene Protein, bmi1 polycomb ring finger oncogene 1a Protein, bmi1 polycomb ring finger oncogene 1b Protein, BMI1 proto-oncogene, polycomb ring finger L homeolog Protein, BMI1 Protein, LOC100230513 Protein, Bmi1 Protein, bmi1a Protein, bmi1b Protein, bmi1.L Protein
- Sujet
- Background: Component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2. Synonyms: Polycomb group RING finger protein 4 RING finger protein 51.
- Poids moléculaire
- 56.8 kD
- NCBI Accession
- NM_005180
- UniProt
- P35226
- Pathways
- Cycle Cellulaire, Autophagy
-