anti-Humain TRIOBP anticorps pour Immunocytochemistry

Recommended TRIOBP Antibody (fourni par: Connectez-vous pour afficher )

Antigène
TRIO and F-Actin Binding Protein (TRIOBP) Anticorps
  • tara
  • DFNB28
  • TARA
  • dJ37E16.4
  • AI428493
  • EST478828
  • Tara
  • mKIAA1662
  • TRIO and F-actin binding protein
  • TRIO and F-actin-binding protein
  • TRIO and F-actin binding protein L homeolog
  • TRIO and F-actin binding protein-like
  • TRIOBP
  • LOC100354753
  • triobp.L
  • TRIOBPL
  • Triobp
Reactivité
Humain, Souris, Rat (Rattus)
25
9
8
3
3
3
3
2
1
1
1
Hôte
Lapin
19
6
Clonalité
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
23
11
4
4
3
3
3
1
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4362544
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN4362546 ICC IF IHC IHC (p) WB Rabbit IgG Center Connectez-vous pour afficher Polyclonal 0
1 ABIN2983929 ICC IF WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN5623389 ICC IF WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène TRIO and F-Actin Binding Protein (TRIOBP) Anticorps
Reactivité Humain, Souris, Rat (Rattus)
(25), (9), (8), (3), (3), (3), (3), (2), (1), (1), (1)
Hôte Lapin
(19), (6)
Clonalité
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(23), (11), (4), (4), (3), (3), (3), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-TRIOBP anticorps

Détail du antigène TRIOBP Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:ATDSRTPEVPAGEGPRRGLGAPLTEDQQNRLSEEIEKKWQELEKLPLRENKRVPLTALLNQSRGERRGPPSDGHEALEKEVQALRAQLEAWRLQGEAPQSA
Isotype IgG

Détail du antigène TRIOBP

Détail du produit anti-TRIOBP anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation TRIOBP (TRIOBP Antibody Extrait)
Sujet Gene Symbol: TRIOBP
ID gène 11078
Pathways Regulation of Actin Filament Polymerization

Information d'application

Détail du produit anti-TRIOBP anticorps Détail du antigène TRIOBP Stockage Images Haut de la page
Indications d'application Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-TRIOBP anticorps Détail du antigène TRIOBP Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-TRIOBP anticorps Détail du antigène TRIOBP Information d'application Stockage Haut de la page
Supplier Images
Western Blotting (WB) image for anti-TRIO and F-Actin Binding Protein (TRIOBP) antibody (ABIN4362544) Western Blot: TRIOBP Antibody - Analysis in mouse cell line NIH-3T3 and rat cell lin...
Western Blotting (WB) image for anti-TRIO and F-Actin Binding Protein (TRIOBP) antibody (ABIN4362544) Western Blot: TRIOBP Antibody - Analysis in human cell line U-87 MG.