anti-Souris FDFT1 anticorps pour Immunohistochemistry

Recommended FDFT1 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1) Anticorps
  • FDFT1
  • DKFZp459C1712
  • SQS
  • SS
  • DGPT
  • ERG9
  • fdft1
  • farnesyl-diphosphate farnesyltransferase 1
  • squalene synthase
  • farnesyl diphosphate farnesyl transferase 1
  • FDFT1
  • fdft1
  • LOC100560926
  • Fdft1
Reactivité
Humain, Souris, Rat (Rattus)
94
26
12
4
3
2
2
2
2
1
1
1
Hôte
Lapin
90
14
Clonalité
Polyclonal
Conjugué
Cet anticorp FDFT1 est non-conjugé
9
9
6
6
6
6
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
101
55
53
14
11
4
4
3
2
2
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4311300
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN1858844 ICC IHC WB Rabbit IgG AA 217-416 Connectez-vous pour afficher Polyclonal 0
1 ABIN1895514 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 1-30 Connectez-vous pour afficher Polyclonal 0
1 ABIN1895515 IHC ELISA WB APC Rabbit IgG AA 1-30 Connectez-vous pour afficher Polyclonal 0
1 ABIN1895516 IHC ELISA WB Biotin Rabbit IgG AA 1-30 Connectez-vous pour afficher Polyclonal 0
1 ABIN1895517 IHC ELISA WB FITC Rabbit IgG AA 1-30 Connectez-vous pour afficher Polyclonal 0
1 ABIN1895518 IHC ELISA WB PE Rabbit IgG AA 1-30 Connectez-vous pour afficher Polyclonal 0
1 ABIN2601745 ELISA IHC WB Rabbit IgG AA 1-30 Connectez-vous pour afficher Polyclonal 0
1 ABIN2881552 IF IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1895519 IHC ELISA WB HRP Rabbit IgG AA 1-30 Connectez-vous pour afficher Polyclonal 0
1 ABIN1840866 IHC IHC (p) WB Rabbit AA 1-30 Connectez-vous pour afficher Polyclonal 0
1 ABIN5700878 ELISA IHC IP WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2968799 IF/ICC IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1086052 IHC ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2753608 IHC ELISA WB Rabbit IgG AA 1-260 Connectez-vous pour afficher Polyclonal 0
1 ABIN2928744 ELISA IF/ICC IHC WB Rabbit AA 217-416 Connectez-vous pour afficher Polyclonal 0

General

Antigène Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1) Anticorps
Reactivité Humain, Souris, Rat (Rattus)
(94), (26), (12), (4), (3), (2), (2), (2), (2), (1), (1), (1)
Hôte Lapin
(90), (14)
Clonalité
Polyclonal
Conjugué Cet anticorp FDFT1 est non-conjugé
(9), (9), (6), (6), (6), (6)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(101), (55), (53), (14), (11), (4), (4), (3), (2), (2), (1)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-FDFT1 anticorps

Détail du antigène FDFT1 Information d'application Stockage References for anti-FDFT1 antibody (ABIN4311300) Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
Isotype IgG

Détail du antigène FDFT1

Détail du produit anti-FDFT1 anticorps Information d'application Stockage References for anti-FDFT1 antibody (ABIN4311300) Images Haut de la page
Antigène
Autre désignation FDFT1 (FDFT1 Antibody Extrait)
Sujet Gene Symbol: FDFT1
ID gène 2222
Pathways Regulation of Lipid Metabolism by PPARalpha

Information d'application

Détail du produit anti-FDFT1 anticorps Détail du antigène FDFT1 Stockage References for anti-FDFT1 antibody (ABIN4311300) Images Haut de la page
Indications d'application Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-FDFT1 anticorps Détail du antigène FDFT1 Information d'application References for anti-FDFT1 antibody (ABIN4311300) Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-FDFT1 antibody (ABIN4311300)

Détail du produit anti-FDFT1 anticorps Détail du antigène FDFT1 Information d'application Stockage Images Haut de la page
Produit citée dans:

Wu, Hsu, Chen, Yu, Chang, Tai, Liu, Su, Chang, Yu: "Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas." dans: Molecular & cellular proteomics : MCP, Vol. 9, Issue 6, pp. 1100-17, 2010

Images

Détail du produit anti-FDFT1 anticorps Détail du antigène FDFT1 Information d'application Stockage References for anti-FDFT1 antibody (ABIN4311300) Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1) antibody (ABIN4311300) Western Blot: FDFT1 Antibody [NBP1-89560] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Western Blotting (WB) image for anti-Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1) antibody (ABIN4311300) Western Blot: FDFT1 Antibody [NBP1-89560] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1) antibody (ABIN4311300) Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human adrena...
Immunofluorescence (IF) image for anti-Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1) antibody (ABIN4311300) Immunocytochemistry/Immunofluorescence: FDFT1 Antibody [NBP1-89560] - Staining of hum...