anti-Humain Era G-Protein-Like 1 (E. Coli) anticorps pour Immunofluorescence

Recommended Era G-Protein-Like 1 (E. Coli) Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Era G-Protein-Like 1 (E. Coli) (ERAL1) Anticorps
  • ERAL1
  • 2610524P08Rik
  • 9130407C09Rik
  • AU019798
  • Era
  • M-ERA
  • MERA-S
  • MERA-W
  • GdERA
  • si:ch211-207c6.1
  • ERA
  • ERAL1A
  • H-ERA
  • HERA-A
  • HERA-B
  • eral1
  • Era like 12S mitochondrial rRNA chaperone 1
  • Era (G-protein)-like 1 (E. coli)
  • Era-like 12S mitochondrial rRNA chaperone 1
  • Era-like 12S mitochondrial rRNA chaperone 1 L homeolog
  • GTP-binding protein era homolog
  • ERAL1
  • Eral1
  • eral1
  • eral1.L
  • eral
Reactivité
Humain
61
10
10
4
4
3
2
2
Hôte
Lapin
57
4
Clonalité
Polyclonal
Conjugué
Inconjugué
3
3
3
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
57
28
14
2
1
1
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4316440
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
0.82264996 ABIN4316439 ICC IF IHC IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène Era G-Protein-Like 1 (E. Coli) (ERAL1) Anticorps
Reactivité Humain
(61), (10), (10), (4), (4), (3), (2), (2)
Hôte Lapin
(57), (4)
Clonalité
Polyclonal
Conjugué Inconjugué
(3), (3), (3), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(57), (28), (14), (2), (1), (1), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:PWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLMDIFLCDVDIRLSVKLLK
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Antigène
Autre désignation GTP Binding Protein Era Homolog (ERAL1 Antibody Extrait)
Sujet Gene Symbol: ERAL1
ID gène 26284
Pathways Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20For IHC-Paraffin HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Era G-Protein-Like 1 (E. Coli) (ERAL1) antibody (ABIN4316440) Immunohistochemistry-Paraffin: GTP binding protein era homolog Antibody [NBP1-89704] ...
Western Blotting (WB) image for anti-Era G-Protein-Like 1 (E. Coli) (ERAL1) antibody (ABIN4316440) Western Blot: GTP binding protein era homolog Antibody [NBP1-89704] - Lane 1: Marker ...
Immunofluorescence (IF) image for anti-Era G-Protein-Like 1 (E. Coli) (ERAL1) antibody (ABIN4316440) Immunocytochemistry/Immunofluorescence: GTP binding protein era homolog Antibody [NBP...
Immunofluorescence (IF) image for anti-Era G-Protein-Like 1 (E. Coli) (ERAL1) antibody (ABIN4316440) Immunocytochemistry/Immunofluorescence: GTP binding protein era homolog Antibody - I...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Era G-Protein-Like 1 (E. Coli) (ERAL1) antibody (ABIN4316440) Immunohistochemistry-Paraffin: GTP binding protein era homolog Antibody - Staining o...