Recevoir ce produit gratuitement
Envoyez-nous votre proposition de validation. J'aimerais valider ce produitRelevance Score | ABIN | Application | Conjugate | Host | Isotype | Epitope | Fournisseur | Clonality | References | Details |
---|---|---|---|---|---|---|---|---|---|---|
0.82264996 | ABIN4316439 | ICC IF IHC IHC (p) WB | Rabbit | IgG | Connectez-vous pour afficher | Polyclonal | 0 |
General |
|
---|---|
Antigène | Era G-Protein-Like 1 (E. Coli) (ERAL1) Anticorps |
Reactivité | Humain Alternatives |
Hôte | Lapin Alternatives |
Clonalité | |
Conjugué | Inconjugué Alternatives |
Application |
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Alternatives
|
Fournisseur | Connectez-vous pour afficher |
Détail du produitDétail du antigène Information d'application Stockage Images |
|
Specificité | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Purification | Immunogen affinity purified |
Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:PWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLMDIFLCDVDIRLSVKLLK |
Isotype | IgG |
Détail du antigèneDétail du produit Information d'application Stockage Images Haut de la page |
|
Antigène | |
Autre désignation | GTP Binding Protein Era Homolog (ERAL1 Antibody Extrait) |
Sujet | Gene Symbol: ERAL1 |
ID gène | 26284 |
Pathways | Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly |
Information d'applicationDétail du produit Détail du antigène Stockage Images Haut de la page |
|
Indications d'application | Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20For IHC-Paraffin HIER pH 6 retrieval is recommended. |
Commentaires |
The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo. |
Restrictions | For Research Use only |
StockageDétail du produit Détail du antigène Information d'application Images Haut de la page |
|
Format | Liquid |
Buffer |
PBS ( pH 7.2) and 40 % Glycerol Buffer contains: 0.02 % Sodium Azide |
Agent conservateur | Sodium azide |
Précaution d'utilisation | This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Stock | 4 °C,-20 °C |
Stockage commentaire | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
ImagesDétail du produit Détail du antigène Information d'application Stockage Haut de la page |
|
Images (Fournisseur) |
|