anti-Humain TECTA anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended TECTA Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Tectorin alpha (TECTA) Anticorps
  • DFNA12
  • DFNA8
  • DFNB21
  • Tctna
  • tectorin alpha
  • TECTA
  • Tecta
Reactivité
Humain
8
2
2
Hôte
Lapin
5
3
Clonalité
Polyclonal
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
7
5
2
1
1
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4358355
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN5518790 IHC (p) WB Rabbit IgG AA 93-134, N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN5647724 IHC (p) WB Rabbit IgG AA 93-134 Connectez-vous pour afficher Polyclonal 0

General

Antigène Tectorin alpha (TECTA) Anticorps
Reactivité Humain
(8), (2), (2)
Hôte Lapin
(5), (3)
Clonalité
Polyclonal
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(7), (5), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-TECTA anticorps

Détail du antigène TECTA Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:VLHTFDGASYAFPSEFSYTLLKTCPERPEYLEIDINKKKPDAGPAWLRGLRILVADQEVKIGGIGASEVKLNGQE
Isotype IgG

Détail du antigène TECTA

Détail du produit anti-TECTA anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation Tectorin alpha (TECTA Antibody Extrait)
Sujet Gene Symbol: TECTA
ID gène 7007
Pathways Sensory Perception of Sound

Information d'application

Détail du produit anti-TECTA anticorps Détail du antigène TECTA Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-TECTA anticorps Détail du antigène TECTA Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-TECTA anticorps Détail du antigène TECTA Information d'application Stockage Haut de la page
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Tectorin alpha (TECTA) antibody (ABIN4358355) Immunohistochemistry-Paraffin: Tectorin alpha Antibody - Staining of human testis sh...