anti-Humain BBS7 anticorps pour Immunocytochemistry

Recommended BBS7 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Bardet-Biedl Syndrome 7 (BBS7) Anticorps
  • BBS7
  • bbs2l1
  • BBS2L1
  • id:ibd5048
  • zgc:153772
  • 8430406N16Rik
  • Bardet-Biedl syndrome 7
  • bardet-biedl syndrome 7
  • Bardet-Biedl syndrome 7 L homeolog
  • Bardet-Biedl syndrome 7 (human)
  • BBS7
  • bbs7
  • MICPUN_100192
  • MICPUCDRAFT_16331
  • bbs7.L
  • Bbs7
Reactivité
Humain
70
26
23
2
2
Hôte
Lapin
50
14
6
Clonalité
Polyclonal
Conjugué
Cet anticorp BBS7 est non-conjugé
5
5
5
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
52
38
13
3
3
2
2
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4283229
Produit non disponible pour cette région.

General

Antigène Bardet-Biedl Syndrome 7 (BBS7) Anticorps
Reactivité Humain
(70), (26), (23), (2), (2)
Hôte Lapin
(50), (14), (6)
Clonalité
Polyclonal
Conjugué Cet anticorp BBS7 est non-conjugé
(5), (5), (5), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(52), (38), (13), (3), (3), (2), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-BBS7 anticorps

Détail du antigène BBS7 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:YVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKG
Isotype IgG
Plasmids, Primers & others

Détail du antigène BBS7

Détail du produit anti-BBS7 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation BBS7 (BBS7 Antibody Extrait)
Sujet Gene Symbol: BBS7
ID gène 55212
Pathways Signalisation Hedgehog

Information d'application

Détail du produit anti-BBS7 anticorps Détail du antigène BBS7 Stockage Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-BBS7 anticorps Détail du antigène BBS7 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-BBS7 anticorps Détail du antigène BBS7 Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Bardet-Biedl Syndrome 7 (BBS7) antibody (ABIN4283229) Western Blot: BBS7 Antibody [NBP1-88690] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunofluorescence (IF) image for anti-Bardet-Biedl Syndrome 7 (BBS7) antibody (ABIN4283229) Immunocytochemistry/ Immunofluorescence: BBS7 Antibody [NBP1-88690] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Bardet-Biedl Syndrome 7 (BBS7) antibody (ABIN4283229) Immunohistochemistry-Paraffin: BBS7 Antibody [NBP1-88690] - Immunohistochemical stain...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Bardet-Biedl Syndrome 7 (BBS7) antibody (ABIN4283229) Immunohistochemistry-Paraffin: BBS7 Antibody - Staining of human fallopian tube show...