anti-Humain LAMTOR2 anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended LAMTOR2 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) Anticorps
  • ENDAP
  • HSPC003
  • MAPBPIP
  • MAPKSP1AP
  • ROBLD3
  • Ragulator2
  • p14
  • 2010111E04Rik
  • AL022628
  • Mapbpip
  • P14
  • Rab25
  • Robld3
  • robld3
  • zgc:100811
  • mapbpip
  • RGD1562501
  • late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
  • LAMTOR2
  • Lamtor2
  • lamtor2
Reactivité
Humain
38
20
18
Hôte
Lapin
38
Clonalité
Polyclonal
Conjugué
Cet anticorp LAMTOR2 est non-conjugé
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
24
19
17
13
9
5
2
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4350844
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN5690038 ELISA IF IHC (p) WB Rabbit IgG AA 40-90 Connectez-vous pour afficher Polyclonal 0
1 ABIN657261 IHC (p) WB Rabbit Ig Fraction AA 41-70, Center Connectez-vous pour afficher Polyclonal 0
1 ABIN4350843 ICC IF IHC IHC (p) Rabbit AA 1-125, N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN1810344 IHC IHC (p) WB Rabbit AA 41-70 Connectez-vous pour afficher Polyclonal 0
1 ABIN1712086 IHC (p) WB HRP Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1701069 IHC (p) WB Biotin Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1714571 IF (p) IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN5587092 IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN3200988 ICC IF IHC (p) Rabbit AA 1-125, N-Term Connectez-vous pour afficher Polyclonal 0

General

Antigène Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) Anticorps
Reactivité Humain
(38), (20), (18)
Hôte Lapin
(38)
Clonalité
Polyclonal
Conjugué Cet anticorp LAMTOR2 est non-conjugé
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(24), (19), (17), (13), (9), (5), (2)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-LAMTOR2 anticorps

Détail du antigène LAMTOR2 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:RPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEP
Isotype IgG
Plasmids, Primers & others

Détail du antigène LAMTOR2

Détail du produit anti-LAMTOR2 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation ROBLD3 (LAMTOR2 Antibody Extrait)
Sujet Gene Symbol: LAMTOR2
ID gène 28956
Pathways Signalisation PI3K-Akt

Information d'application

Détail du produit anti-LAMTOR2 anticorps Détail du antigène LAMTOR2 Stockage Images Haut de la page
Indications d'application Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-LAMTOR2 anticorps Détail du antigène LAMTOR2 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-LAMTOR2 anticorps Détail du antigène LAMTOR2 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody [NBP1-87951] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunohistochemistry-Paraffin: ROBLD3 Antibody [NBP1-87951] - Staining of human stoma...
Western Blotting (WB) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Western Blot: ROBLD3 Antibody [NBP1-87951] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunohistochemistry-Paraffin: ROBLD3 Antibody [NBP1-87951] - Staining of human colon...
Immunofluorescence (IF) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody - Immunofluorescent staining...