anti-Humain C4B anticorps pour Western Blotting

Recommended C4B Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Complement Component 4B (C4B) Anticorps
  • C4B1
  • C4B12
  • C4B2
  • C4B3
  • C4B5
  • C4BD
  • C4B_2
  • C4F
  • CH
  • CO4
  • CPAMD3
  • wu:fi14a03
  • C4B
  • DKFZP469I0332
  • C4
  • Ss
  • C4-2
  • C4l
  • complement C4B (Chido blood group)
  • complement component 4
  • complement C4-B
  • complement component 4B (Chido blood group)
  • C4B
  • c4
  • LOC462577
  • C4b
Reactivité
Humain
101
30
2
1
1
1
1
1
1
Hôte
Lapin
80
37
8
3
1
1
Clonalité
Polyclonal
Conjugué
Cet anticorp C4B est non-conjugé
12
11
6
4
4
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
87
64
34
19
19
13
12
12
10
7
6
6
4
3
1
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Images

N° du produit ABIN634315
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
11.801548 ABIN2138041 IP ELISA WB Mouse IgG1 kappa Connectez-vous pour afficher 52H10 0
11.801548 ABIN2688550 ELISA WB Mouse IgG1 kappa Connectez-vous pour afficher M81471 0
10.694759 ABIN1866966 ICC IHC WB Rabbit IgG AA 975-1336 Connectez-vous pour afficher Polyclonal 0
10 ABIN513870 IF ELISA WB Mouse IgG2b kappa AA 1347-1446 Connectez-vous pour afficher 1F2 0
7.6947594 ABIN1866970 ICC IHC WB Rabbit IgG AA 680-756 Connectez-vous pour afficher Polyclonal 0
7.6947594 ABIN2896739 IF/ICC IHC IP WB Rabbit AA 680-756 Connectez-vous pour afficher Polyclonal 0
7 ABIN364282 ELISA FACS IHC IHC (p) WB Chicken IgY Connectez-vous pour afficher Polyclonal 0
7 ABIN1804101 ELISA FACS IHC IHC (fro) IHC (p) WB Mouse IgG1 Connectez-vous pour afficher 10-12 0
7 ABIN560119 ELISA WB Mouse IgG2b kappa AA 1347-1446 Connectez-vous pour afficher 2E3 0
4.6947594 ABIN2777022 WB Rabbit N-Term Connectez-vous pour afficher Polyclonal 1
4.6947594 ABIN5535559 WB Rabbit Ig Fraction AA 655-684 Connectez-vous pour afficher Polyclonal 0
4.6947594 ABIN1854872 WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
4.6947594 ABIN2896740 IF/ICC IHC IP WB Rabbit AA 680-756 Connectez-vous pour afficher Polyclonal 0
4 ABIN333174 IP ELISA WB Mouse IgG1, kappa Connectez-vous pour afficher 0
4 ABIN2466913 FACS IHC ELISA WB Chicken IgY Connectez-vous pour afficher Polyclonal 0
4 ABIN560118 ELISA WB Mouse AA 1347-1446 Connectez-vous pour afficher Polyclonal 0
4 ABIN513869 ELISA WB Mouse AA 774-873 Connectez-vous pour afficher Polyclonal 0
4 ABIN1732498 FACS IHC (p) ELISA WB Chicken IgY Connectez-vous pour afficher Polyclonal 0
4 ABIN1112874 WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1827480 ELISA WB Mouse IgG2b, kappa AA 1347-1446 Connectez-vous pour afficher 2E3 0

General

Antigène Complement Component 4B (C4B) Anticorps
Reactivité Humain
(101), (30), (2), (1), (1), (1), (1), (1), (1)
Hôte Lapin
(80), (37), (8), (3), (1), (1)
Clonalité
Polyclonal
Conjugué Cet anticorp C4B est non-conjugé
(12), (11), (6), (4), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(87), (64), (34), (19), (19), (13), (12), (12), (10), (7), (6), (6), (4), (3), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-C4B anticorps

Détail du antigène C4B Information d'application Stockage Images
Purification Affinity purified
Immunogène Complement C4 b antibody was raised using a synthetic peptide corresponding to a region with amino acids QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM
Plasmids, Primers & others

Détail du antigène C4B

Détail du produit anti-C4B anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation Complement C4b (C4B Antibody Extrait)
Sujet C4B is the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene encodes the basic form of complement factor 4, part of the classical activation pathway.
Poids moléculaire 33 kDa (MW of target protein)
Pathways Système du Complément

Information d'application

Détail du produit anti-C4B anticorps Détail du antigène C4B Stockage Images Haut de la page
Indications d'application WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Commentaires

Complement C4b Blocking Peptide, catalog no. 33R-7746, is also available for use as a blocking control in assays to test for specificity of this Complement C4b antibody

Restrictions For Research Use only

Stockage

Détail du produit anti-C4B anticorps Détail du antigène C4B Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Détail du produit anti-C4B anticorps Détail du antigène C4B Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Complement Component 4B (C4B) antibody (ABIN634315) Complement C4b antibody used at 1 ug/ml to detect target protein.