anti-Humain C4B anticorps pour Western Blotting

Recommended C4B Antibody

Antigène
Complement Component C4b (C4b) Anticorps
  • C4B1
  • C4B12
  • C4B2
  • C4B3
  • C4B5
  • C4BD
  • C4B_2
  • C4F
  • CH
  • CO4
  • CPAMD3
  • wu:fi14a03
  • C4B
  • DKFZP469I0332
  • C4
  • Ss
  • C4-2
  • C4l
  • complement C4B (Chido blood group)
  • complement component 4
  • complement C4-B
  • complement component 4B (Chido blood group)
  • C4B
  • c4
  • LOC462577
  • C4b
Reactivité
Humain
91
29
2
2
1
1
1
1
1
1
Hôte
Lapin
85
22
7
3
1
Clonalité
Polyclonal
Conjugué
Cet anticorp C4B est non-conjugé
12
10
5
4
4
2
2
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
70
48
31
17
17
12
11
11
10
7
6
4
4
3
1
Options

Images

N° du produit ABIN634315
$ 449.29
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
13.656681 ABIN2138041 IP ELISA WB Mouse IgG1 kappa 52H10 0
13.656681 ABIN2688550 ELISA WB Mouse IgG1 kappa M81471 0
10.877543 ABIN1866966 ICC IHC WB Rabbit IgG AA 975-1336 Polyclonal 0
10 ABIN513870 IF ELISA WB Mouse IgG2b kappa AA 1347-1446 1F2 0
8.5 ABIN2192496 ELISA WB Mouse IgG1 kappa 25-3F4 2
7.8775434 ABIN1866970 ICC IHC WB Rabbit IgG AA 680-756 Polyclonal 0
7.8775434 ABIN2896739 IF/ICC IHC IP WB Rabbit AA 680-756 Polyclonal 0
7 ABIN364282 ELISA FACS IHC IHC (p) WB Chicken IgY Polyclonal 0
7 ABIN1804101 ELISA FACS IHC IHC (fro) IHC (p) WB Mouse IgG1 10-12 0
7 ABIN560119 ELISA WB Mouse IgG2b kappa AA 1347-1446 2E3 0
5.5 ABIN2763585 ELISA IF IHC IP WB Mouse IgG2b kappa 99-72-18 1
5.5 ABIN2763584 ELISA IF IHC IP WB Mouse IgG2b kappa 99-72-18 1
4.8775434 ABIN2777022 WB Rabbit N-Term Polyclonal 1
4.8775434 ABIN5535559 WB Rabbit Ig Fraction AA 655-684 Polyclonal 0
4.8775434 ABIN1854872 WB Rabbit IgG Polyclonal 0
4.8775434 ABIN2896740 IF/ICC IHC IP WB Rabbit AA 680-756 Polyclonal 0
4 ABIN6743078 WB Rabbit AA 144-193 Polyclonal 0
4 ABIN333174 IP ELISA WB Mouse IgG1, kappa 0
4 ABIN513869 ELISA WB Mouse AA 774-873 Polyclonal 0
4 ABIN560118 ELISA WB Mouse AA 1347-1446 Polyclonal 0

General

Antigène Complement Component C4b (C4b) Anticorps
Reactivité Humain
(91), (29), (2), (2), (1), (1), (1), (1), (1), (1)
Hôte Lapin
(85), (22), (7), (3), (1)
Clonalité
Polyclonal
Conjugué Cet anticorp C4B est non-conjugé
(12), (10), (5), (4), (4), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(70), (48), (31), (17), (17), (12), (11), (11), (10), (7), (6), (4), (4), (3), (1)
Fournisseur

Détail du produit anti-C4B anticorps

Détail du antigène C4B Information d'application Stockage Images
Purification Affinity purified
Immunogène Complement C4 b antibody was raised using a synthetic peptide corresponding to a region with amino acids QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM
Plasmids, Primers & others

Détail du antigène C4B

Détail du produit anti-C4B anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation Complement C4b (C4b Antibody Extrait)
Sujet C4B is the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene encodes the basic form of complement factor 4, part of the classical activation pathway.
Poids moléculaire 33 kDa (MW of target protein)
Pathways Système du Complément

Information d'application

Détail du produit anti-C4B anticorps Détail du antigène C4B Stockage Images Haut de la page
Indications d'application WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Commentaires

Complement C4b Blocking Peptide, catalog no. 33R-7746, is also available for use as a blocking control in assays to test for specificity of this Complement C4b antibody

Restrictions For Research Use only

Stockage

Détail du produit anti-C4B anticorps Détail du antigène C4B Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Détail du produit anti-C4B anticorps Détail du antigène C4B Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Complement Component 4B (C4B) antibody (ABIN634315) Complement C4b antibody used at 1 ug/ml to detect target protein.