PTH anticorps (AA 1-38)

N° du produit ABIN110066

Cet anticorps Souris Monoclonal détecte spécifiquement PTH dans ELISA, RIA et IHC (fro). Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour PTH anticorps (AA 1-38) (ABIN110066)

Antigène: PTH (Parathyroid Hormone (PTH))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp PTH est non-conjugé

Application: ELISA, Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))

Clone: A1-64

Détail du produit anti-PTH anticorps

Épitope: AA 1-38

Specificité: Human PTH peptide (aa 15-25 1-34 1-38 1-84 7-84) There were no cross reactivities obtained with synthetic human PTH (aa 1-3 1-10 4-16 28-48 39-84 44-68 53-84), PTHrP (aa 1-86)

Purification: Purified

Immunogène: Synthetic human PTH (aa 1-38) poly Lysin conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalg)

Information d'application

Indications d'application: RIA (25 ng/ml) Immunohistochemistry (cryo-sections and paraffin-sections 2 microg/ml) ELISA (1 microg/ml)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Stock: 4 °C

Détails sur PTH

Antigène: PTH (Parathyroid Hormone (PTH))

Autre désignation: Parathyroid Hormone

Classe de substances: Hormone

Sujet: Cell culture supernatant, affinity purified, 50 mM TRIS pH 7,4 NaN3 0.05%

ID gène: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process