PTH anticorps (AA 1-38)
-
- Antigène Voir toutes PTH Anticorps
- PTH (Parathyroid Hormone (PTH))
-
Épitope
- AA 1-38
-
Reactivité
- Humain
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp PTH est non-conjugé
-
Application
- ELISA, Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Specificité
- Human PTH peptide (aa 15-25 1-34 1-38 1-84 7-84) There were no cross reactivities obtained with synthetic human PTH (aa 1-3 1-10 4-16 28-48 39-84 44-68 53-84), PTHrP (aa 1-86)
- Purification
- Purified
- Immunogène
- Synthetic human PTH (aa 1-38) poly Lysin conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalg)
- Clone
- A1-64
- Top Product
- Discover our top product PTH Anticorps primaire
-
-
- Indications d'application
- RIA (25 ng/ml) Immunohistochemistry (cryo-sections and paraffin-sections 2 microg/ml) ELISA (1 microg/ml)
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Resuspend in aqua bidest.
- Stock
- 4 °C
-
- Antigène
- PTH (Parathyroid Hormone (PTH))
- Autre désignation
- Parathyroid Hormone (PTH Produits)
- Synonymes
- anticorps PTH1, anticorps Pthp, anticorps PTH-(1-84), anticorps Pth1, anticorps Pthr1, anticorps PTH, anticorps parathyroid hormone, anticorps parathyroid hormone S homeolog, anticorps PTH, anticorps Pth, anticorps pth.S
- Classe de substances
- Hormone
- Sujet
- Cell culture supernatant, affinity purified, 50 mM TRIS pH 7,4 NaN3 0.05%
- ID gène
- 5741
- Pathways
- cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process
-