PTH anticorps (N-Term)
-
- Antigène Voir toutes PTH Anticorps
- PTH (Parathyroid Hormone (PTH))
-
Épitope
- AA 1-38, N-Term
-
Reactivité
- Humain
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp PTH est non-conjugé
-
Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro)), Enzyme Immunoassay (EIA)
- Specificité
- This antibody detects PTH peptide (aa 15-25, 1-34, 1-38, 1-84, 7-84). There were no cross reactivities obtained with synthetic PTH (aa 1-3, 1-10, 4-16, 28-48, 39-84, 44-68, 53-84) and PTHrP (aa 1-86).
- Attributs du produit
- Synonyms: Parathormone, Parathyrin
- Purification
- Protein A Chromatography.
- Immunogène
- Synthetic human PTH (aa 1-38) poly Lysin conjugated. AA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG
- Clone
- A1-70
- Isotype
- IgG1
- Top Product
- Discover our top product PTH Anticorps primaire
-
anti-Parathyroid Hormone (PTH) antibody
PTH Reactivité: Humain WB, IF Hôte: Lapin Monoclonal unconjugated
anti-Parathyroid Hormone (PTH) (AA 32-115) antibodyPTH Reactivité: Humain IHC, StM Hôte: Lapin Monoclonal PTH-2295R unconjugated Recombinant Antibody
anti-Parathyroid Hormone (PTH) (AA 1-34) antibodyPTH Reactivité: Humain IHC Hôte: Lapin Monoclonal MSVA-525R unconjugated Recombinant Antibody
anti-Parathyroid Hormone (PTH) (AA 32-115) antibodyPTH Reactivité: Rat IHC, WB, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Parathyroid Hormone (PTH) (AA 32-115) antibodyPTH Reactivité: Humain IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Parathyroid Hormone (PTH) (Internal Region) antibodyPTH Reactivité: Humain ELISA, WB, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Parathyroid Hormone (PTH) (AA 1-115) antibodyPTH Reactivité: Humain ELISA, WB Hôte: Souris Monoclonal 2C7 unconjugated
anti-Parathyroid Hormone (PTH) (AA 1-34) antibodyPTH Reactivité: Humain IHC, StM Hôte: Lapin Monoclonal PTH-1717R unconjugated Recombinant Antibody
anti-Parathyroid Hormone (PTH) (AA 1-34) antibodyPTH Reactivité: Humain IHC, StM Hôte: Souris Monoclonal rPTH-911 unconjugated Recombinant Antibody
anti-Parathyroid Hormone (PTH) (AA 71-115) antibodyPTH Reactivité: Humain IHC, ELISA, IHC (p) Hôte: Chèvre Polyclonal unconjugated
-
- Indications d'application
-
RIA: 20 ng/mL. Immunohistochemistry (Cryo-Sections and Paraffin Sections): 2 μg/mL. ELISA: 1 μg/mL.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user. - Restrictions
- For Research Use only
-
- Reconstitution
- Restore in aqua bidest to 1 mg/mL
- Buffer
- PBS, pH 7.4
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
Store lyophilized at 2-8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch. - Date de péremption
- 12 months
-
- Antigène
- PTH (Parathyroid Hormone (PTH))
- Autre désignation
- Parathyroid Hormone / PTH (PTH Produits)
- Synonymes
- anticorps PTH1, anticorps Pthp, anticorps PTH-(1-84), anticorps Pth1, anticorps Pthr1, anticorps PTH, anticorps parathyroid hormone, anticorps parathyroid hormone S homeolog, anticorps PTH, anticorps Pth, anticorps pth.S
- Classe de substances
- Hormone
- Sujet
- Parathyroid hormone (PTH), or Parathormone, is secreted by the parathyroid glands as a polypeptide containing 84 amino acids. It acts to increase the concentration of calcium in the blood, whereas calcitonin (a hormone produced by the parafollicular cells of the thyroid gland) acts to decrease calcium concentration.Synonyms: Parathormone, Parathyrin
- ID gène
- 5741
- UniProt
- P01270
- Pathways
- cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process
-
