PTH anticorps (N-Term)
-
- Antigène Voir toutes PTH Anticorps
- PTH (Parathyroid Hormone (PTH))
-
Épitope
- AA 1-38, N-Term
-
Reactivité
- Humain
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp PTH est non-conjugé
-
Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro)), Enzyme Immunoassay (EIA)
- Specificité
- This antibody detects PTH peptide (aa 15-25, 1-34, 1-38, 1-84, 7-84). There were no cross reactivities obtained with synthetic PTH (aa 1-3, 1-10, 4-16, 28-48, 39-84, 44-68, 53-84) and PTHrP (aa 1-86).
- Attributs du produit
- Synonyms: Parathormone, Parathyrin
- Purification
- Protein A Chromatography.
- Immunogène
- Synthetic human PTH (aa 1-38) poly Lysin conjugated. AA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG
- Clone
- A1-70
- Isotype
- IgG1
- Top Product
- Discover our top product PTH Anticorps primaire
-
-
- Indications d'application
-
RIA: 20 ng/mL. Immunohistochemistry (Cryo-Sections and Paraffin Sections): 2 μg/mL. ELISA: 1 μg/mL.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user. - Restrictions
- For Research Use only
-
- Reconstitution
- Restore in aqua bidest to 1 mg/mL
- Buffer
- PBS, pH 7.4
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
Store lyophilized at 2-8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch. - Date de péremption
- 12 months
-
- Antigène
- PTH (Parathyroid Hormone (PTH))
- Autre désignation
- Parathyroid Hormone / PTH (PTH Produits)
- Synonymes
- anticorps PTH1, anticorps Pthp, anticorps PTH-(1-84), anticorps Pth1, anticorps Pthr1, anticorps PTH, anticorps parathyroid hormone, anticorps parathyroid hormone S homeolog, anticorps PTH, anticorps Pth, anticorps pth.S
- Classe de substances
- Hormone
- Sujet
- Parathyroid hormone (PTH), or Parathormone, is secreted by the parathyroid glands as a polypeptide containing 84 amino acids. It acts to increase the concentration of calcium in the blood, whereas calcitonin (a hormone produced by the parafollicular cells of the thyroid gland) acts to decrease calcium concentration.Synonyms: Parathormone, Parathyrin
- ID gène
- 5741
- UniProt
- P01270
- Pathways
- cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process
-