Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

ERK1 anticorps (AA 372-406)

L’anticorps anti-ERK1 Polyclonal Lapin est utilisé pour la détection de ERK1 dans des échantillons de Souris, Rat, Lapin et Hamster. Il a été validé pour WB, IP et Func.
N° du produit ABIN199418
1.155,99 €
Plus frais de livraison 40,00 € et TVA
100 μg
Destination: France
Envoi sous 15 à 20 jours ouvrables

Aperçu rapide pour ERK1 anticorps (AA 372-406) (ABIN199418)

Antigène

Voir toutes ERK1 (MAPK3) Anticorps
ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Reactivité

  • 254
  • 186
  • 144
  • 44
  • 20
  • 18
  • 16
  • 12
  • 10
  • 9
  • 9
  • 7
  • 7
  • 7
  • 5
  • 3
  • 3
  • 3
  • 2
  • 1
  • 1
  • 1
  • 1
Souris, Rat, Lapin, Hamster

Hôte

  • 256
  • 32
  • 3
  • 1
  • 1
Lapin

Clonalité

  • 199
  • 94
Polyclonal

Conjugué

  • 131
  • 18
  • 15
  • 13
  • 7
  • 6
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 3
  • 3
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
Cet anticorp ERK1 est non-conjugé

Application

  • 248
  • 106
  • 82
  • 74
  • 71
  • 67
  • 65
  • 54
  • 45
  • 33
  • 18
  • 11
  • 7
  • 5
  • 2
  • 2
  • 1
Western Blotting (WB), Immunoprecipitation (IP), Functional Studies (Func)
  • Épitope

    • 73
    • 59
    • 30
    • 24
    • 16
    • 15
    • 15
    • 11
    • 10
    • 9
    • 8
    • 7
    • 6
    • 5
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 372-406

    Specificité

    Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35, mouse: 34/35, human: 32/35.

    Homologie

    Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).

    Purification

    Immunoaffinity purified

    Immunogène

    Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

    Type of Immunogen: Synthetic peptide - KLH conjugated

    Isotype

    IgG
  • Indications d'application

    Approved: Func, IP, WB (0.1 - 2 μg/mL)

    Usage: Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 μg/mL detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 μg immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/mL) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.

    Commentaires

    Target Species of Antibody: Rat

    Restrictions

    For Research Use only
  • Format

    Liquid

    Concentration

    Lot specific

    Buffer

    0.2 M Tris-glycine,  pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 0.1 mM EDTA.

    Agent conservateur

    Sodium azide

    Précaution d'utilisation

    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

    Conseil sur la manipulation

    Avoid repeat freeze-thaw cycles.

    Stock

    4 °C,-20 °C

    Stockage commentaire

    Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
  • Antigène

    ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

    Autre désignation

    MAPK3 / ERK1

    Sujet

    Name/Gene ID: MAPK3
    Subfamily: MAPK
    Family: Protein Kinase

    Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3

    ID gène

    5595

    UniProt

    P27361

    Pathways

    Signalisation MAPK, Signalisation RTK, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins
Vous êtes ici:
Chat with us!